Summary - LfDB (LfDB0022)
LECTIN ID LfDB0022
Lectin Name Killer cell lectin-like receptor subfamily K member 1
NK cell receptor D
NKG2-D activating NK receptor
Nkg2d type II integral membrane protein
Pfam Family Lectin_C
Monosaccharide Specificity
Common Name (Scientific Name) Human  ( Homo sapiens  )
Japanese Name (Family) ヒト  ( ヒト科 )
Kingdom Animal
Organ Natural killer cells 
Number of CRD 1
3D-fold others 
Accession (External Link) GenBank: AF260135   AF260136   AF461811   AJ001687   BC039836   X54870  
PDB: 1HQ8   1HYR   1JSK   1KCG   1MPU  
Pfam: PF00059  
Sequence
MDYEILFSDETMNYADAGTYCQSRGMALVSSAMRDSTMVKAILAFTEVKGHDYWVGADNLQDGAYNFLWNDGVSLPTDSDLWSPNEPSNPQSWQLCVQIW
SKYNLLDDVGCGGARRVICEKELDD
Reference   Immunity 1999 (10) 577-84 Crystal structure of the MHC class I homolog MIC-A, a gammadelta T cell ligand. [10367903]
  Nat Immunol. 2001 (2) 443-51 Complex structure of the activating immunoreceptor NKG2D and its MHC class I-like ligand MICA. [11323699]
  Structure 2003 (11) 411-22 Symmetry recognizing asymmetry: analysis of the interactions between the C-type lectin-like immunoreceptor NKG2D and MHC class I-like ligands. [12679019]
  Immunity 2001 (15) 1039-49 Conformational plasticity revealed by the cocrystal structure of NKG2D and its class I MHC-like ligand ULBP3. [11754823]
  Nat Immunol. 2001 (2) 248-54 Crystal structure of the murine NK cell-activating receptor NKG2D at 1.95 A. [11224525]
  Immunity 2002 (16) 77-86 Crystal structures of RAE-1beta and its complex with the activating immunoreceptor NKG2D. [11825567]
Molecular Structure