GlycoProtDB ID - GPDB0001172


Protein Name Alpha-1-antitrypsin 1-1
Protein Accession Number A0A0A0MQA3
Gene Serpina1a
Length 436
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MYCAIRVRLS RLFTVKGQKA RWKMTPSISW GLLLLAGLCC LVPSFLAEDV QETDTSQKDQ SPASHEIATN LGDFAISLYR ELVHQSNTSN IFFSPVSIAT
AFAMLSLGSK GDTHTQILEG LQFNLTQTSE ADIHKSFQHL LQTLNRPDSE LQLSTGNGLF VNNDLKLVEK FLEEAKNHYQ AEVFSVNFAE SEEAKKVIND
FVEKGTQGKI AEAVKKLDQD TVFALANYIL FKGKWKKPFD PENTEEAEFH VDESTTVKVP MMTLSGMLHV HHCSTLSSWV LLMDYAGNAT AVFLLPDDGK
MQHLEQTLSK ELISKFLLNR RRRLAQIHFP RLSISGEYNL KTLMSPLGIT RIFNNGADLS GITEENAPLK LSQAVHKAVL TIDETGTEAA AVTVLQMVPM
SMPPILRFDH PFLFIIFEEH TQSPIFLGKV VDPTHK

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
87 NTS 81 - 110
ELVHQSNTSNIFFSPVSIATAFAMLSLGSK
Shared ( 9 )
81 - 99
ELVHQSNTSNIFFSPVSIA
Shared ( 9 )
81 - 110
ELVHQSNTSNIFFSPVSIATAFAMLSLGSK
Shared ( 9 )
124 NLT 111 - 135
GDTHTQILEGLQFNLTQTSEADIHK
Shared ( 7 )
288 NAT
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Serum Skeletal_muscle Stomach Testis
ConA Amide80 ConA RCA120 Amide80 ConA RCA120 AAL RCA120 AAL(+) AAL(+) AAL ConA RCA120 RCA120 RCA120 RCA120 Amide80 Amide80 ConA RCA120 Amide80 ConA RCA120 RCA120
           
 
         
   
             
                   
                           
     
 
   
 
 
           
 
   
 
                                                 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05