GlycoProtDB ID - GPDB0001312


Protein Name Adhesion G protein-coupled receptor L4 (Fragment)
Protein Accession Number A0A0G2JGY1
Gene Adgrl4
Length 181
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
MRLLPLLVGF STLLNCSYTQ NCSKTTCLPN AKCEVHNGVE ACFCSQGYSG NGVTICEDID ECSESSVCGD HAVCENVNGG FSCFCREGYQ TATGKSQFTP
NDGSYCQESM NSNCHLEHAC IAANINKTLK RIGPITEQTT LLQEIYRNSE AELSLMDIVT YIEILTESSS LLGHPNSTTS Y

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
15 NCS
21 NCS
126 NKT 96 - 127
SQFTPNDGSYCQESMNSNCHLEHACIAANINK
Shared ( 2 )
176 NST
Heart
ConA
 
 
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05