GlycoProtDB ID - GPDB0001402


Protein Name Biotinidase
Protein Accession Number A0A0R4J131
Gene Btd
Length 529
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
MRSRFMVCIM SGARTAPALF FLGCSALALG VSSASQEHRE AEYYVAAVYE HPSVLSPNPL ELVSRQEALE LMKQNLDVYE QQVMAAAQKG VQIIVFPEDG
IHGFNFTRTS IYPFLDFMPS PKLVRWNPCL EPFRFNDTEV LQRLSCMAIK GGMFLVANLG TKQPCLSSDP GCPQDGRYQF NTNVVFSDNG TLVDRYRKHN
LYFEAAFDTP ANVDLITFDT PFAGKFGVFT CFDILFFDPA VRLLRDFEVK HIVYPTAWMN QLPLLAAIEI QKAFATAFGV NVLAANIHHP TLGMTGSGIH
TPLKSFWYHD MDDPKGHLII AQVATNPQGL TGTGNTTSEM DPSHRKFLKI LSGDPYCEKD AQEVHCDEAA KWNVNVPPTF HSEMMYDNFT LVPVWGTEGH
LQVCSNSLCC HLLYERPTLS KELYALGVFD GLHTVHGTYY IQTCALVKCG GLGFDTCGQE ITEAEGLFDF HLWGNFSTLY IFPLFLTSGM TLDTPDQLGW
ENDHYFLRKR GLSSGLVTAA LYGRLYERK

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
105 NFT 90 - 108
GVQIIVFPEDGIHGFNFTR
Shared ( 2 )
136 NDT 135 - 143
FNDTEVLQR
Shared ( 7 )
189 NGT 178 - 195
YQFNTNVVFSDNGTLVDR
Shared ( 2 )
335 NTT 316 - 346
GHLIIAQVATNPQGLTGTGNTTSEMDPSHRK
Shared ( 2 )
316 - 346
GHLIIAQVATNPQGLTGTGNTTSEMDPSHRK
Shared ( 2 )
316 - 345
GHLIIAQVATNPQGLTGTGNTTSEMDPSHR
Shared ( 2 )
316 - 345
GHLIIAQVATNPQGLTGTGNTTSEMDPSHR
Shared ( 2 )
388 NFT
475 NFS
Brain Colon Heart Kidney Kidney(Fut9 KO) Liver Liver: b4GalT-I(+/+) Lung Skeletal_muscle Testis
ConA Amide80 ConA ConA AAL(+) AAL ConA RCA120 ConA ConA ConA
     
   
       
 
   
 
   
           
       
 
 
       
 
 
 
     
     
   
       
                   
                     
                     
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05