GlycoProtDB ID - GPDB0001453


Protein Name 4F2 cell-surface antigen heavy chain
Protein Accession Number A0A0U1RPK4
Gene Slc3a2
Length 303
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
MKEALSSWLQ DGVDGFQFRD VGKLMNAPLY LAEWQNITKN LSEDRLLIAG TESSDLQQIV NILESTSDLL LTSSYLSNST FTGERTESLV TRFLNATGSQ
WCSWSVSQAG LLADFIPDHL LRLYQLLLFT LPGTPVFSYG DELGLQGALP GQPAKAPLMP WNESSIFHIP RPVSLNMTVK GQNEDPGSLL TQFRRLSDLR
GKERSLLHGD FHALSSSPDL FSYIRHWDQN ERYLVVLNFR DSGRSARLGA SNLPAGISLP ASAKLLLSTD SARQSREEDT SLKLENLSLN PYEGLLLQFP
FVA

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
36 NIT 20 - 45
DVGKLMNAPLYLAEWQNITKNLSEDR
Shared ( 8 )
24 - 45
LMNAPLYLAEWQNITKNLSEDR
Shared ( 8 )
24 - 39
LMNAPLYLAEWQNITK
Shared ( 8 )
24 - 45
LMNAPLYLAEWQNITKNLSEDR
Shared ( 8 )
24 - 39
LMNAPLYLAEWQNITK
Shared ( 8 )
31 - 39
LAEWQNITK
Shared ( 8 )
40 NLS 20 - 45
DVGKLMNAPLYLAEWQNITKNLSEDR
Shared ( 8 )
24 - 45
LMNAPLYLAEWQNITKNLSEDR
Shared ( 8 )
24 - 45
LMNAPLYLAEWQNITKNLSEDR
Shared ( 8 )
78 NST 61 - 92
NILESTSDLLLTSSYLSNSTFTGERTESLVTR
Shared ( 6 )
62 - 92
ILESTSDLLLTSSYLSNSTFTGERTESLVTR
Shared ( 6 )
62 - 85
ILESTSDLLLTSSYLSNSTFTGER
Shared ( 6 )
65 - 92
STSDLLLTSSYLSNSTFTGERTESLVTR
Shared ( 6 )
95 NAT 93 - 122
FLNATGSQWCSWSVSQAGLLADFIPDHLLR
Shared ( 6 )
162 NES 156 - 180
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
156 - 180
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
156 - 180
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
156 - 180
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
176 NMT 156 - 180
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
156 - 180
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
156 - 180
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
156 - 180
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
168 - 180
HIPRPVSLNMTVK
Shared ( 7 )
286 NLS
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach Testis
AAL ConA RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120 AAL ConA RCA120 AAL(+) AAL(+) AAL RCA120 RCA120 RCA120 RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120 ConA RCA120
                 
                                 
               
       
                       
         
     
 
 
                 
                                 
   
 
   
 
     
 
 
 
                         
                         
                 
                                 
               
       
                       
                 
                                 
                         
                         
                         
                         
                         
                         
                         
                         
                               
                 
       
   
     
     
   
   
     
               
                           
                         
           
           
                 
 
     
 
       
   
     
     
   
   
     
               
                           
                         
           
           
                 
 
     
 
                         
                         
                                                     
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05