GlycoProtDB ID - GPDB0001503


Protein Name CUB domain-containing protein 1 (Fragment)
Protein Accession Number A0A172Q395
Gene Cdcp1
Length 636
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
EIALPQRSGV TVSIKLGNPA LPVKICYIVM SRQHITELII RPGERKSFTF SCSNPEKHFV LKIEKNIDCM SGPCPFGEVH LQPSTSELPI LNRTFIWDVR
AHKSIGLELQ FATPRLRQIG PGESCADGVT HSISGHIDAT EVRIGTFCSN GTVSRIKMQE GVKMALHLPW FHRRNVSGFS IANRSSIKRL CIIESVFEGE
GSATLMSANY PGGFPEDELM TWQFVVPAHL RASVSFLNFN VSNCERKEER VEYYIPGSTT NPEVFRLEDK QPGNMAGNFN LSLQGCDQDA QSPGILRLQF
QVLVQRPQDE SNKTYMVDLS RERTMSLTIE PRPVKHGRRF VPGCFVCLES RTCSTNVTLT AGSIHKISFL CDDLTRLWVN VEKTLSCLDH RYCYRQSFKL
QVPDYILQLP VQLHDFSWKL LVPKDKLSLM LVPGQKLQQH TQERPCNTSF GYHVTSTTPG QDLYFGSFCS GGSIEKIQVK QNSSVTLRAY APSFQQEVSK
QGLIVSYTPY FKEEGIFTVT PDTKNKVYLR SPNWDRGLPA LSSVSWNISV PSNQVACLTV LKERSGLACQ SGRAFMIIQE QQSRAEEIFS LEEEVLPKPS
FHHHSFWVNI SNCSPMNGKQ LDLLFWVTLT PRTVDL

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
92 NRT 66 - 93
NIDCMSGPCPFGEVHLQPSTSELPILNR
Shared ( 2 )
150 NGT 144 - 155
IGTFCSNGTVSR
Shared ( 8 )
175 NVS 175 - 184
NVSGFSIANR
Shared ( 3 )
183 NRS 175 - 184
NVSGFSIANR
Shared ( 3 )
240 NVS 232 - 246
ASVSFLNFNVSNCER
Shared ( 3 )
232 - 247
ASVSFLNFNVSNCERK
Shared ( 3 )
280 NLS
312 NKT 298 - 313
LQFQVLVQRPQDESNK
Shared ( 3 )
356 NVT 352 - 366
TCSTNVTLTAGSIHK
Shared ( 3 )
447 NTS 437 - 476
LQQHTQERPCNTSFGYHVTSTTPGQDLYFGSFCSGGSIEK
Shared ( 3 )
482 NSS
547 NIS
609 NIS
612 NCS
Colon Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Stomach
Amide80 RCA120 ConA RCA120 AAL(+) AAL(+) RCA120 SSA RCA120 RCA120 ConA RCA120 Amide80 ConA RCA120
   
                       
 
   
               
           
               
           
       
     
           
                           
                             
                           
           
     
               
           
                             
                             
                             
                             
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05