GlycoProtDB ID - GPDB0001568


Protein Name Cadherin-related family member 5
Protein Accession Number A0PJK7
Gene Cdhr5
Length 831
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
MGAPALLWPS LLLPWLTVLF GQPPGTLAQT QVCSVNQTIF RVEENTTVSE PLVNIFVPDG LHVTLGPLST PYAFRIEGKD LFLNVTPDYE ENSLLQADVE
CKRGDAVVVR LEVFVAVLDI NDNAPKFSFE IKTFNVSEDT KVNTTVIPET QLKATDADIN DILVYTLQEV TPNASKFFSL EGVNYPALKL DQTLDYFKNQ
NMTFMLLARD TWEENVEPSH TATATLVLNT LPADLRTPWF LPCSFTDGYV CIHAQYSAVV PTGHKLPSPL IMSPGPIYAV DGDQAINQSI IYSIIAGNTD
GTFIINAHDG NLTMTKSIPS PMKFTLLIRA DQEDMAQYSV TQAIVEARSV TGNPLQFSQS LYYGTVVLGS EAGTAVKDKT FPSEILRIQA QYPGFPDLNS
AVTYRVTNSS EFMMNKDIML TAVPMEEART IRVEVEASNT VTKDTATAVV EIQVSERELP STEFPTPPEA GGTTGPSSNT TMEAPLTSGT SQRPATTSSG
GSVGPFPPGG TTLRPPTPAS SIPGGSPTLG TSTSPQTTTP GGDSAQTPKP GTSHPTAPTS RTSTSLMTTS SRSDSTQTPK PGTSQPMVPI PGASTSSQPA
TPSGSSPQTP KPGTSQSTAT GPISGAGEQG DGQRFSTVDM AVLGGVLGAL LLLALICLVI LVHKHYRHRL ACCSGKASEP QPSGYDNLTF LPDHKAKWSP
TPNRKPEPSP KLAQPPLRPP SPMSSSPTPP SSTPPSPQPK ASGSPKTVQA GDSPSAVRSI LTKERRPEGE GGYKAVWFGK DIGAEADVVV LNEPTADVDS
ASASGSEGSD DDDPDQKKTL RFGVDADNTY I

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
36 NQT
45 NTT
84 NVT 80 - 102
DLFLNVTPDYEENSLLQADVECK
Shared ( 3 )
135 NVS 133 - 176
TFNVSEDTKVNTTVIPETQLKATDADINDILVYTLQEVTPNASK
Shared ( 3 )
133 - 153
TFNVSEDTKVNTTVIPETQLK
Shared ( 3 )
133 - 141
TFNVSEDTK
Shared ( 3 )
143 NTT 133 - 176
TFNVSEDTKVNTTVIPETQLKATDADINDILVYTLQEVTPNASK
Shared ( 3 )
133 - 153
TFNVSEDTKVNTTVIPETQLK
Shared ( 3 )
142 - 153
VNTTVIPETQLK
Shared ( 3 )
173 NAS 164 - 176
VYTLQEVTPNASK
Shared ( 3 )
133 - 176
TFNVSEDTKVNTTVIPETQLKATDADINDILVYTLQEVTPNASK
Shared ( 3 )
154 - 176
ATDADINDILVYTLQEVTPNASK
Shared ( 3 )
201 NMT 199 - 209
NQNMTFMLLAR
Shared ( 3 )
199 - 209
NQNMTFMLLAR
Shared ( 3 )
199 - 209
NQNMTFMLLAR
Shared ( 3 )
287 NQS
311 NLT 307 - 316
AHDGNLTMTK
Shared ( 4 )
408 NSS 406 - 416
VTNSSEFMMNK
Shared ( 5 )
406 - 416
VTNSSEFMMNK
Shared ( 5 )
388 - 416
IQAQYPGFPDLNSAVTYRVTNSSEFMMNK
Shared ( 5 )
406 - 416
VTNSSEFMMNK
Shared ( 5 )
479 NTT
687 NLT
Colon Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver: b4GalT-I(+/+)
Amide80 AAL RCA120 AAL(+) AAL(+) RCA120
           
           
   
 
 
       
 
 
   
 
 
       
 
 
     
 
       
 
 
       
   
 
     
 
     
 
   
           
     
 
     
   
 
       
     
   
         
           
           
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05