GlycoProtDB ID - GPDB0001578


Protein Name C230096C10Rik protein
Protein Accession Number A1L2Z3
Gene Emc1
Length 997
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
MAVAVASGFW IWAAVLLVPV AAVYEDQVGK FDWRQQYVGK IKFASLEFSP GSKKLVVATE KNVIAALNSR TGEILWRHVD KGTAEGAVDA MLVHGQDAIT
VSNGGRLMRS WETNIGGLNW EITLDTGSFQ ALGLVGLQES VRYIAVLKKT TLTLHHLSSG HLKWVEHLPE SDSILYQMVY SYGSGVVWAL GIVPFSHVNI
VKFNVEDGEI VQQVRVWTPW LQHLTGACGV VDEAVLVCPD PSSHSLHTLA LETEWELRQI PLQSPDLEFG SGFQPQVLPT QPSPVAPSRA QFFLQLSPSH
YALLHYHHGA VTLLKNFPQA TLVSFATTGE KTVAAVMTCR TEVQKPVSAG DGSVASFPET SGAQDSLACF NQTYTINLYL VETGRRLLDT SISFSLEQKG
TRPEQLYIQV FLKKDDSVGY RALVQTQDHL QLFLQQLAGK VVLWSREESL AEVVCLEMVD LPLTGAQAEL EGEFGKKAAI QDGLLGMFLK RLSSQLILLQ
AWTSHLWKMF YDARKPRSQI KNEINIDTLA RDEFNLQKMM VTVTASGKLF GIESSSGTIL WKQYLPNVKP DSSFKLMVQR TTAHFPHPPQ CTLLVKDKET
GMSSLFVFNP IFGKWSQVAP PVLKRPILQS LLLPVMDQDY AKVLLLVDDE YKVTAFPATR NVLRQLHELA PSIFFYLVDA EQGRLSGYQL RKDLTTELSW
ELTIPPEVQR VVKVKGKRSS EHVHSQGRVM GDRSVLYKSL NPNLLAVVTE STDVHHERTF IGIFLIDGVT GRIIHSSVQK KARGPVHLVH SENWVVYQYW
NSKARRNELT ALELYEGTEQ YNATAFSSLD RPQLPQVLQQ SYIFPSSISA MEATITERGI TSRHLLIGLP SGAILSLPKA LLDPRRPEIP TEQSREENLI
PYSPDVQVHA ERFINYNQTV SRMRGIYTAP SGLESTCLVV AYGLDIYQTR VYPSKQFDVL KDDYDYVLIS SVLFGLVFAT MITKRLAQVK LLNRAWR

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
371 NQT 341 - 386
TEVQKPVSAGDGSVASFPETSGAQDSLACFNQTYTINLYLVETGRR
Shared ( 4 )
822 NAT
917 NQT 886 - 922
RPEIPTEQSREENLIPYSPDVQVHAERFINYNQTVSR
Shared ( 5 )
913 - 922
FINYNQTVSR
Shared ( 5 )
Brain Colon Heart Kidney Liver Lung Skeletal_muscle Stomach Testis
ConA RCA120 ConA RCA120 ConA ConA AAL ConA RCA120 WGA ConA ConA ConA ConA
                     
   
                           
                     
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05