GlycoProtDB ID - GPDB0001785


Protein Name Adam22 protein (Fragment)
Protein Accession Number A4FUT9
Gene Adam22
Length 855
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
AGSGGASFWL LCVLGTCPLA RCGRAGVASL KGLERGKENR FLERQSIIPL RLIYRLGGED ETQHNQLDTR VRGDPGGPQL THVDKASFRV DAFGTSFVLD
VLLNHELLSS GYVERQIEHG GKVVENKGGE HCYYQGQIRG NPVSFVALST CHGLHGMFYD GNHTYLIEPE ENEKSQESSH CHSVYKSRQF EFPLDDLPSE
FQRVNITPPQ FILKPRLKRR KRQLLRFPRN VEEETKYIEL MIVNDHLMFK KHRLSVVYTN TYAKSVVNMA DVIYKDQLKT RIVLVAMETW AADNKFAISE
NPLITLREFM KYRRDFIKEK ADAVHLFSGS QFESSRSGAA YIGGICSLLR GGGVNEFGKT DLMAVTLAQS LAHNVGIISD KRKLASGECK CEDTWSGCIM
GDTGYYLPKK FTQCNVEEYH DFLNSGGGAC LFNKPSKLLD PPECGNGFIE TGEECDCGTP AECALEGAEC CKKCTLTQDS QCSDGLCCKK CKFQPLGTVC
REAVNDCDIR EICSGNSSQC APNVHKMDGY SCDGTQGICF GGRCKTRDRQ CKYIWGQKVT ASDRYCYEKL NIEGTEKGNC GKDKDTWTQC NKRDVLCGYL
LCTNIGNIPR LGELDGEITS TLVVQQGRTL NCSGAHVKLE EDVDLGYVED GTPCGPQMMC LEHRCLPVAS FNFSTCSSSK AGTVCSGNGV CSNELKCVCN
RHWTGADCGT HFPHNDDAKT GITLSGNGVA GTNIIIGIIA GTILVLALIL GITAWGYKNY REQRQLPQGD YVKKPGDGDS FYSDFPPGGS TNSASSSKKR
SNGLSHSWSE RIPDTKHISD ICENGRPRSN SWQGNMGGNK KKIRGKRFRP RSNST

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
162 NHT
205 NIT
505 NDC
516 NSS 511 - 543
EICSGNSSQCAPNVHKMDGYSCDGTQGICFGGR
Shared ( 24 )
511 - 526
EICSGNSSQCAPNVHK
Shared ( 24 )
631 NCS 629 - 638
TLNCSGAHVK
Shared ( 25 )
672 NFS 665 - 680
CLPVASFNFSTCSSSK
Shared ( 25 )
853 NST
Brain Heart Kidney(Fut9 KO) Kidney(Fut9 WT) Stomach
ConA RCA120 ConA AAL(+) AAL(+) ConA
           
           
           
         
   
 
 
     
   
           
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05