GlycoProtDB ID - GPDB0001847


Protein Name Asialoglycoprotein receptor 2 (Fragment)
Protein Accession Number B1AR35
Gene Asgr2
Length 226
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
MEKDCQDIQQ LDSEENDHQL SGDDEHGSHV QDPRIENPHW KGQPLSRPFP QRLCSTFRLS LLALAFNILL LVVICVVSSQ SIQLQEEFRT LKETFSNFSS
STLMEFGALD TLGGSTNAIL TSWLAQLEEK QQQLKADHST LLFHLKHFPM DLRTLTCQLA YFQSNGTECC PVNWVEFGGS CYWFSRDGLT WAEADQYCQL
ENAHLLVINS REEQDFVVKH RSQFHI

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
97 NFS
165 NGT 154 - 186
TLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSR
Shared ( 3 )
Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-)
RCA120 RCA120
   
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05