GlycoProtDB ID - GPDB0001933


Protein Name CD84 antigen
Protein Accession Number B2RU38
Gene Cd84
Length 329
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
MAQRHLWIWF LCLQTWSEAA GKDADPMVMN GILGESVTFL LNIQEPKKID NIAWTSQSSV AFIKPGVNKA EVTITQGTYK GRIEIIDQKY DLVIRDLRME
DAGTYKADIN EENEETITKI YYLHIYRRLK TPKITQSLIS SLNNTCNITL TCSVEKEEKD VTYSWSPFGE KSNVLQIVHS PMDQKLTYTC TAQNPVSNSS
DSVTVQQPCT DTPSFHPRHA VLPGGLAVLF LLILIPMLAF LFRLYKRRRD RIVLEADDVS KKTVYAVVSR NAQPTESRIY DEIPQSKMLS CKKDPVTTIY
SSVQLSEKMK ETNMKDRSLP KALGNEIVV

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
143 NNT 134 - 159
ITQSLISSLNNTCNITLTCSVEKEEK
Shared ( 6 )
134 - 156
ITQSLISSLNNTCNITLTCSVEK
Shared ( 6 )
144 NTC 134 - 156
ITQSLISSLNNTCNITLTCSVEK
Shared ( 6 )
147 NIT 134 - 156
ITQSLISSLNNTCNITLTCSVEK
Shared ( 6 )
134 - 159
ITQSLISSLNNTCNITLTCSVEKEEK
Shared ( 6 )
134 - 156
ITQSLISSLNNTCNITLTCSVEK
Shared ( 6 )
198 NSS 186 - 218
LTYTCTAQNPVSNSSDSVTVQQPCTDTPSFHPR
Shared ( 6 )
Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-)
WGA RCA120 RCA120
   
 
   
   
   
 
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05