GlycoProtDB ID - GPDB0002160


Protein Name Cadherin-2
Protein Accession Number D3YYT0
Gene Cdh2
Length 849
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
MKFSNCNRKR KVQYESSEPA DFKVDEDGTV YAVRSFPLTA EQAKFLIYAQ DKETQEKWQV AVNLSREPTL TEEPMKEPHE IEEIVFPRQL AKHSGALQRQ
KRDWVIPPIN LPENSRGPFP QELVRIRSDR DKNLSLRYSV TGPGADQPPT GIFIINPISG QLSVTKPLDR ELIARFHLRA HAVDINGNQV ENPIDIVINV
IDMNDNRPEF LHQVWNGSVP EGSKPGTYVM TVTAIDADDP NALNGMLRYR ILSQAPSTPS PNMFTINNET GDIITVAAGL DREKVQQYTL IIQATDMEGN
PTYGLSNTAT AVITVTDVND NPPEFTAMTF YGEVPENRVD VIVANLTVTD KDQPHTPAWN AAYRISGGDP TGRFAILTDP NSNDGLVTVV KPIDFETNRM
FVLTVAAENQ VPLAKGIQHP PQSTATVSVT VIDVNENPYF APNPKIIRQE EGLHAGTMLT TLTAQDPDRY MQQNIRYTKL SDPANWLKID PVNGQITTIA
VLDRESPNVK NNIYNATFLA SDNGIPPMSG TGTLQIYLLD INDNAPQVLP QEAETCETPE PNSINITALD YDIDPNAGPF AFDLPLSPVT IKRNWTINRL
NGDFAQLNLK IKFLEAGIYE VPIIITDSGN PPKSNISILR VKVCQCDSNG DCTDVDRIVG AGLGTGAIIA ILLCIIILLI LVLMFVVWMK RRDKERQAKQ
LLIDPEDDVR DNILKYDEEG GGEEDQDYDL SQLQQPDTVE PDAIKPVGIR RLDERPIHAE PQYPVRSAAP HPGDIGDFIN EGLKAADNDP TAPPYDSLLV
FDYEGSGSTA GSLSSLNSSS SGGDQDYDYL NDWGPRFKKL ADMYGGGDD

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
63 NLS
133 NLS
216 NGS
268 NET 251 - 284
ILSQAPSTPSPNMFTINNETGDIITVAAGLDREK
Shared ( 3 )
251 - 284
ILSQAPSTPSPNMFTINNETGDIITVAAGLDREK
Shared ( 3 )
345 NLT
515 NAT
565 NIT
594 NWT 593 - 599
RNWTINR
Shared ( 4 )
635 NIS 634 - 642
SNISILRVK
Shared ( 4 )
613 - 640
FLEAGIYEVPIIITDSGNPPKSNISILR
Shared ( 4 )
817 NSS
Brain Heart Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Stomach
ConA Amide80 ConA AAL(+) AAL(+) RCA120 RCA120 RCA120 RCA120
                 
                 
                 
     
       
 
 
     
                 
                 
                 
 
     
 
           
 
         
     
                 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05