GlycoProtDB ID - GPDB0002268


Protein Name A disintegrin and metallopeptidase domain 22 isoform
Protein Accession Number D6QSS8
Gene Adam22
Length 904
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
MQAAAAASFW LLCVLGTCPL ARCGRAGVAS LKGLERGKEN RFLERQSIIP LRLIYRLGGE DETQHNQLDT RVRGDPGGPQ LTHVDKASFR VDAFGTSFVL
DVLLNHELLS SGYVERQIEH GGKVVENKGG EHCYYQGQIR GNPVSFVALS TCHGLHGMFY DGNHTYLIEP EENEKSQESS HCHSVYKSRQ FEFPLDDLPS
EFQRVNITPP QFILKPRLKR RKRQLLRFPR NVEEETKYIE LMIVNDHLMF KKHRLSVVYT NTYAKSVVNM ADVIYKDQLK TRIVLVAMET WAADNKFAIS
ENPLITLREF MKYRRDFIKE KADAVHLFSG SQFESSRSGA AYIGGICSLL RGGGVNEFGK TDLMAVTLAQ SLAHNVGIIS DKRKLASGEC KCEDTWSGCI
MGDTGYYLPK KFTQCNVEEY HDFLNSGGGA CLFNKPSKLL DPPECGNGFI ETGEECDCGT PAECALEGAE CCKKCTLTQD SQCSDGLCCK KCKFQPLGTV
CREAVNDCDI REICSGNSSQ CAPNVHKMDG YSCDGTQGIC FGGRCKTRDR QCKYIWGQKV TASDRYCYEK LNIEGTEKGN CGKDKDTWTQ CNKRDVLCGY
LLCTNIGNIP RLGELDGEIT STLVVQQGRT LNCSGAHVKL EEDVDLGYVE DGTPCGPQMM CLEHRCLPVA SFNFSTCSSS KAGTVCSGNG VCSNELKCVC
NRHWTGADCG THFPHNDDAK TGITLSGNGV AGTNIIIGII AGTILVLALI LGITAWGYKN YREQRQLPQG DYVKKPGDGD SFYSDFPPGG STNSASSSKK
RSNGLSHSWS ERIPDTKHIS DICENGRPRS NSWQGNMGGN KKKIRGKRFR PRSNSTETLS PAKSPSSSTG SIASSRKYPY PMPPLPDEGK TAGRQSARLW
ETSI

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
163 NHT
206 NIT
506 NDC
517 NSS 512 - 544
EICSGNSSQCAPNVHKMDGYSCDGTQGICFGGR
Shared ( 24 )
512 - 527
EICSGNSSQCAPNVHK
Shared ( 24 )
632 NCS 630 - 639
TLNCSGAHVK
Shared ( 25 )
673 NFS 666 - 681
CLPVASFNFSTCSSSK
Shared ( 25 )
854 NST
Brain Heart Kidney(Fut9 KO) Kidney(Fut9 WT) Stomach
ConA RCA120 ConA AAL(+) AAL(+) ConA
           
           
           
         
   
 
 
     
   
           
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05