GlycoProtDB ID - GPDB0002355


Protein Name Carboxylic ester hydrolase
Protein Accession Number E9PV38
Gene Ces2g
Length 560
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
MPRNQMHSWL DAVFFGLLLL LGHVQGHDSP ETSPIRSTHS GQVQGRLIHV KDTKAGVHTF LGIPFAKPPV GPLRFAPPEA PEPWSGVRDG TSQPAICPQN
VT
MNMEGLKE LKLTLPPVSM SEDCLYLNIY TPAHAQEGSN LPVMVWIHGG ALTVGMASMY DGSVLAATED VVVVAIQYRL GVLGFFSTGD EHARGNWGFL
DQVAALRWVQ QNIAHFGGNP DRVTIFGESA GGISVSSHVV SPMSKGLFHR AIMESGVALL PGTIFSFSEV VYQTVAKLSG CEAMDSEALV RCLRGKSEEE
ILAISKNFQM IPGVVDGEFL PKHPQELLAS ADFHPVPSII GFNNDEYGWI VPKVIGSTQT IKGITRENLQ AVLKDTAPQM MLPPECSDLL MEEYMEDIED
PKTLQIQFTE MMEDFMFVIP SLQVAYFQRS HAPVYFYEFQ HQSSFLKDVR PPHVNADHGD EVPFVFGSFF WGMKLNLTEE EKLLNRRMMK YWANFARHGN
PNSESLPYWP VFDHDEQYLQ LNIQPAVGQF QKARKLQFWT KTLPRKIEEL KRSQNVHKEL

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
100 NVT 89 - 109
DGTSQPAICPQNVTMNMEGLK
Shared ( 2 )
75 - 109
FAPPEAPEPWSGVRDGTSQPAICPQNVTMNMEGLK
Shared ( 2 )
89 - 109
DGTSQPAICPQNVTMNMEGLK
Shared ( 2 )
89 - 112
DGTSQPAICPQNVTMNMEGLKELK
Shared ( 2 )
476 NLT 475 - 482
LNLTEEEK
Shared ( 4 )
Colon Heart Liver Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach Testis
ConA ConA AAL ConA RCA120 ConA ConA ConA ConA
       
 
             
 
             
 
     
         
 
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05