GlycoProtDB ID - GPDB0002423


Protein Name Amine oxidase
Protein Accession Number E9PYN9
Gene Aoc1
Length 756
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
MRLAQMSLAF GWAAVILLLQ TADTASAVTT PHDKARIFAD LSPQEIKAVH SFLMSRKELG LESSKNLTLA KNSVFLIEML LPKKKNVLKF LDEGRKSPVR
EARAIIFFGA QDHPNVTEFA VGPLPRPCYV QALSPRPGHH LSWSSRPIST AEYDLLYHML NRAITPLHQF FLDTTGFSFL GCDDRFLTFT DVAPRGVESG
QRRSWLIVQR YVEGYFLHPT GLEILVDHSS TDVQDWRVEQ LWYNGKFYNS PEELAQKYAV GEVEAVVLEE VVLEDPLPGA TEQPPLFSSY KPRGEFHTPV
TVAGPHVVQP SGPRYKLEGN VVLYGDWSFS YRLRSSSGLQ IFNVLFGGER VAYEVSVQEA VALYGGHTPA GMQTKYIDVG WGLGSVTHEL APGIDCPETA
TFLDAFHYYD SDGPVLYPRA LCLFEMPTGV PLRRHFDSNF KGGFNFYAGL KGYVLVLRTT STVYNYDYIW DFIFYPNGVM ETKMHATGYV HATFYTPEGL
RHGTRLQTHL LGNIHTHLVH YRVDLDVAGT KNSFRTLKTK LENITNPWSP SHSLVQPTLE QTQYSHEHQA AFRFGQTLPK YLLFSSPQKN RWGHRRSYRL
QIHSMAEQVL PPGWQEERAV TWARYPLAVT KYRESERYSS SLYNQNDPWD PPVVFEEFLR NNENIENEDL VAWVTVGFLH IPHSEDVPNT ATPGNCVGFL
IRPFNFFEED PSLASRDTVI VWPQDNGLNH VQRWIPENRD CLVSPPFSYN GTYKPV

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
66 NLT
115 NVT
543 NIT 541 - 573
LENITNPWSPSHSLVQPTLEQTQYSHEHQAAFR
Shared ( 3 )
750 NGT
Colon
Amide80
 
 
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05