GlycoProtDB ID - GPDB0002534


Protein Name ATP-binding cassette sub-family A member 7
Protein Accession Number E9Q6G4
Gene Abca7
Length 2167
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
1501
1601
1701
1801
1901
2001
2101
MALGTQLMLL LWKNYTYRRR QPIQLLVELL WPLFLFFILV AVRHSHPPLE HHECHFPNKP LPSAGTVPWL QGLVCNVNNS CFQHPTPGEK PGVLSNFKDS
LISRLLADTR TVLGGHSIQD MLDALGKLIP VLRAVGGGAR PQESDQPTSQ GSVTKLLEKI LQRASLDPVL GQAQDSMRKF SDAIRDLAQE LLTLPSLMEL
RALLRRPRGS AGSLELVSEA LCSTKGPSSP GGLSLNWYEA NQLNEFMGPE VAPALPDNSL SPACSEFVGT LDDHPVSRLL WRRLKPLILG KILFAPDTNF
T
RKLMAQVNQ TFEELALLRD LHELWGVLGP QIFNFMNDST NVAMLQRLLD VGGTGQRQQT PRAQKKLEAI KDFLDPSRGG YSWREAHADM GRLAGILGQM
MECVSLDKLE AVPSEEALVS RALELLGERR LWAGIVFLSP EHPLDPSELS SPALSPGHLR FKIRMDIDDV TRTNKIRDKF WDPGPSADPF MDLRYVWGGF
VYLQDLLEQA AVRVLGGGNS RTGLYLQQMP HPCYVDDVFL RVLSRSLPLF LTLAWIYSVA LTVKAVVREK ETRLRETMRA MGLSRAVLWL GWFLSCLGPF
LVSAALLVLV LKLGNILPYS HPVVIFLFLA AFAVATVAQS FLLSAFFSRA NLAAACGGLA YFALYLPYVL CVAWRERLHL GGLLAASLLS PVAFGFGCES
LALLEEQGDG AQWHNLGTGP AEDVFSLAQV SAFLLLDAVI YGLALWYLEA VCPGQYGIPE PWNFPFRRSY WCGPGPPKSS VLAPAPQDPK VLVEEPPLGL
VPGVSIRGLK KHFRGCPQPA LQGLNLDFYE GHITAFLGHN GAGKTTTLSI LSGLFPPSSG SASILGHDVQ TNMAAIRPHL GICPQYNVLF DMLTVEEHVW
FYGRLKGVSA AAMGPERERL IRDVGLTLKR DTQTRHLSGG MQRKLSVAIA FVGGSRVVIM DEPTAGVDPA SRRGIWELLL KYREGRTLIL STHHLDEAEL
LGDRVAMVAG GSLCCCGSPL FLRRHLGCGY YLTLVKSSQS LVTHDAKGDS EDPRREKKSD GNGRTSDTAF TRGTSDKSNQ APAPGAVPIT PSTARILELV
QQHVPGAQLV EDLPHELLLV LPYAGALDGS FAMVFQELDQ QLELLGLTGY GISDTNLEEI FLKVVEDAHR EGGDSRPQLH LRTCTPQPPT GPEASVLENG
ELAKLVLDPQ APQGLAPNAA QVQGWTLTCQ QLRALLHKRF LLARRSRRGL FAQVVLPALF VGLALFFSLI VPPFGQYPPL QLSPAMYGPQ VSFFSEDAPG
DPNRMKLLEA LLGEAGLQEP SMQDKDARGS ECTHSLACYF TVPEVPPDVA SILASGNWTP ESPSPACQCS QPGARRLLPD CPAGAGGPPP PQAVAGLGEV
VQNLTGRNVS DFLVKTYPSL VRRGLKTKKW VDEVRYGGFS LGGRDPDLPT GHEVVRTLAE IRALLSPQPG NALDRILNNL TQWALGLDAR NSLKIWFNNK
GWHAMVAFVN RANNGLLHAL LPSGPVRHAH SITTLNHPLN LTKEQLSEAT LIASSVDVLV SICVVFAMSF VPASFTLVLI EERITRAKHL QLVSGLPQTL
YWLGNFLWDM CNYLVAVCIV VFIFLAFQQR AYVAPENLPA LLLLLLLYGW SITPLMYPAS FFFSVPSTAY VVLTCINLFI GINSSMATFV LELLSDQNLQ
EVSRILKQVF LIFPHFCLGR GLIDMVRNQA MADAFERLGD KQFQSPLRWD IIGKNLLAMM AQGPLFLLIT LLLQHRNRLL PQSKPRLLPP LGEEDEDVAQ
ERERVTKGAT QGDVLVLRDL TKVYRGQRNP AVDRLCLGIP PGECFGLLGV NGAGKTSTFR MVTGDTLPSS GEAVLAGHNV AQERSAAHRS MGYCPQSDAI
FDLLTGREHL ELFARLRGVP EAQVAQTALS GLVRLGLPSY ADRPAGTYSG GNKRKLATAL ALVGDPAVVF LDEPTTGMDP SARRFLWNSL LSVVREGRSV
VLTSHSMEEC EALCTRLAIM VNGRFRCLGS SQHLKGRFGA GHTLTLRVPP DQPEPAIAFI RITFPGAELR EVHGSRLRFQ LPPGGRCTLT RVFRELAAQG
RAHGVEDFSV SQTTLEEVFL YFSKDQGEEE ESSRQEAEEE EVSKPGRQHP KRVSRFLEDP SSVETMI

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
14 NYT
78 NNS
79 NSC
299 NFT 292 - 303
ILFAPDTNFTRK
Shared ( 5 )
309 NQT
337 NDS
1357 NWT
1403 NLT 1376 - 1407
RLLPDCPAGAGGPPPPQAVAGLGEVVQNLTGR
Shared ( 4 )
1376 - 1415
RLLPDCPAGAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVK
Shared ( 4 )
1377 - 1415
LLPDCPAGAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVK
Shared ( 4 )
1408 NVS 1376 - 1415
RLLPDCPAGAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVK
Shared ( 4 )
1377 - 1415
LLPDCPAGAGGPPPPQAVAGLGEVVQNLTGRNVSDFLVK
Shared ( 4 )
1479 NLT
1540 NLT 1528 - 1543
HAHSITTLNHPLNLTK
Shared ( 4 )
1683 NSS
Brain Colon Heart Liver: b4GalT-I(+/+) Skeletal_muscle Stomach
ConA ConA ConA RCA120 ConA ConA
           
           
           
     
   
           
           
           
         
   
     
   
     
   
     
   
     
           
 
 
           
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05