GlycoProtDB ID - GPDB0002556


Protein Name Cadherin-related family member 2
Protein Accession Number E9Q7P9
Gene Cdhr2
Length 1308
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
MAWLWLLCAL LPAFMVSVTA NSPPSFGVNM TLVTLPEDLP VGAVAFWLVA TDSDNDHLTY GISGPNASYF SVNANTGEVK LASPLDFETV PFFKITISTS
DGLNIRTAEM QVIVEDRNDN IPVFLNTEFS TSINETLPVG SVVFSVLAED KDTGTAGLVQ YFIEKVIPST ANSNNLFRIL ENGSIVLNDT LSYNNKSAFY
QLELKACDSG GILDNKPKTQ CSQPVFVSIS VIDEPDLDPR FIREFYSASV AEDATLGTSV LTVEAVDSDK GINDIVTYSV SNSTRPGWFD IREDGVIFVN
GS
LDREQLLL ENEEVQIQVT ATEKNLNIYG QEAKASMWVT IRVTDVNDHK PEFYNCSLPG CSFSPQEAQV NFIGYVDEHA SARISIDGLT MVAYDPDQGD
NGTFLLSLNG QDAEAFNVSP ERAAGSVSVQ VVVRNSEMVD YEKETVMVVE VVATDSVSNN YSVATVTIHL RNINDHRPVF SQSLYELTVP EHCPTGYLVT
DKIQATDLDG DEWGPITYSL LPGNGADLFE VEPNSGNLTV KNGTLLDREK QAVYYLTLQA TDGGNQSTTT ALEITLLDIN DNPPVVRGSY NVFVPEENGN
VS
VTIQAYDD DQPDTNNSLL VFSLLPGPYS SNFSLDPNTG LLRNLGPLDR EAIDPALEGR IVLTVIVADC GEPSLSTNVN VTITVEDIND NLPVFNQSYE
FSVWERVPGA WVGTVKAWDA DQTAANNRIS FSLSGTGANN FILQGNVLEQ GWAEGSLWLL PDVRLDYETQ KFFHLTVSAE NPGPQGLDST ANVTVTVMDV
NDEPPTLDAA SLQAISVTEN GSEHGQVTRV IAQDVDTAAL LRIELVDVIC TKAGVDVGSV CHGWFSVDGN GSVYINQSEA IDYEACHLVT LVVRAYDLNT
DPGFDAYSSN GSLLINIKDK NDNAPYFLPN NQTFVIIPEL VLPNQQVASV QARDEDSEDN GIIMFSILKA EFVRKDGTSN PVQVFRITRS VEAGLFTGSI
ELVTNLDSTI QGTYQVTVQA QDQPTLGPAL ETQTTLNLFT VDQSYRVRLQ FSTSKEDVGA NMEEIKEALI QATRTSVYVV TIQNIDSTAR ARASSYMDAY
FVFSNGTALT LTELNMMIRK DQDALRQLLQ LGLVVVSSQE SQEPDQQKLL TSVIIGLVVS LVLVLVILIT ALVCLRKSYH RKLRAMKAGK EARKTPIETT
APTAAIPGTN MYNTDRANPV LDLPTKDLGL ECHSSSDLDY DSLNSLDENS VDLDMDSKEF KRKDLPGDPP EPDPEPLTAV LSGRSAGASE QQKKNLSFTN
PGLDTTDL

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
29 NMT
66 NAS
134 NET
182 NGS 179 - 196
ILENGSIVLNDTLSYNNK
Unique
188 NDT 179 - 196
ILENGSIVLNDTLSYNNK
Unique
195 NKS 179 - 196
ILENGSIVLNDTLSYNNK
Unique
282 NST
300 NGS
355 NCS 343 - 383
VTDVNDHKPEFYNCSLPGCSFSPQEAQVNFIGYVDEHASAR
Unique
401 NGT
417 NVS
460 NYS
537 NLT 519 - 541
SLLPGNGADLFEVEPNSGNLTVK
Unique
503 - 541
IQATDLDGDEWGPITYSLLPGNGADLFEVEPNSGNLTVK
Unique
542 NGT
565 NQS
600 NVS
616 NNS
632 NFS
680 NVT
696 NQS
792 NVT
820 NGS
870 NGS
876 NQS
910 NGS 895 - 918
AYDLNTDPGFDAYSSNGSLLINIK
Shared ( 2 )
931 NQT
1105 NGT
1295 NLS
Colon Kidney(Fut9 KO) Kidney(Fut9 WT)
Amide80 AAL(+) AAL(+)
     
     
     
 
 
 
     
     
 
     
     
     
   
   
     
     
     
     
     
     
     
     
     
     
     
   
     
     
     
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05