GlycoProtDB ID - GPDB0002684


Protein Name All-trans retinoic acid-induced differentiation factor (Fragment)
Protein Accession Number F6RYG0
Gene Atraid
Length 183
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
XLGVERALAL PEICTLCPGG MHNLSRVAAY CEDTSKLMQA RCCLNQKGTI LGLDLQNCSL KDPGPNFLQA YTAIIIDLQA NPLKDDLANT FRGFTQLQTL
ILPQDVPCPG GSNAWDNVTS FKDKQICQGQ RDLCNSTGSP EMCPENGSCA SDGPGLLQCV CADGFHGYKC MRQPSPFYFG EPS

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
23 NLS 10 - 26
LPEICTLCPGGMHNLSR
Shared ( 4 )
57 NCS 48 - 61
GTILGLDLQNCSLK
Shared ( 6 )
117 NVT 85 - 122
DDLANTFRGFTQLQTLILPQDVPCPGGSNAWDNVTSFK
Shared ( 4 )
93 - 122
GFTQLQTLILPQDVPCPGGSNAWDNVTSFK
Shared ( 4 )
135 NST 132 - 169
DLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYK
Shared ( 4 )
132 - 169
DLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYK
Shared ( 4 )
146 NGS 132 - 169
DLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYK
Shared ( 4 )
132 - 169
DLCNSTGSPEMCPENGSCASDGPGLLQCVCADGFHGYK
Shared ( 4 )
Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Skeletal_muscle Stomach Testis
Amide80 Amide80 ConA AAL(+) AAL(+) RCA120 RCA120 Amide80 ConA Amide80 ConA
     
           
 
                 
 
     
             
       
           
               
   
     
             
               
   
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05