GlycoProtDB ID - GPDB0002732


Protein Name Alpha-2-macroglobulin receptor-associated protein (Fragment)
Protein Accession Number F6WMD1
Gene Lrpap1
Length 153
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
XELHSDLKIQ ERDELNWKKL KDRLRSINQG LDRLRKVSHQ GYGSTTEFEE PRVIDLWDLA QSANFTEKEL ESFREELKHF EAKIEKHNHY QKQLEISHQK
LKHVESIGDP EHISRNKEKY VLLEEKTKEL GYKVKKHLQD LSSRVSRARH NEL

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
64 NFT 53 - 68
VIDLWDLAQSANFTEK
Shared ( 9 )
37 - 68
VSHQGYGSTTEFEEPRVIDLWDLAQSANFTEK
Shared ( 9 )
Brain Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver
ConA ConA ConA AAL(+) AAL(+) AAL
 
 
 
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05