GlycoProtDB ID - GPDB0002886


Protein Name Calcium-activated chloride channel regulator 4A
Protein Accession Number G3X8Z1
Gene Clca4a
Length 925
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
MMAFSRGPVF LLLLLYLLWG SDTSLIRLNE NGYEDIIIAI DPAVPEDTTI IEHIKGMVTK ASTYLFEATE KRFFFKNVSI LIPESWKDSP QYRRPKQESY
KHADIKVAPP TVEGRDEPYT RQFTQCEEKA EYIHFTPDFV LGRKQDEYGD SGKVLVHEWA HLRWGVFDEY NEDQPFYSAS SKKIEATRCS TGITGTNRVY
ACQGGSCAMR RCRTNSTTKL YEKDCQFFPD KVQSEKASIM FMQSIDSVTE FCKKENHNRE APTLHNKKCN YRSTWEVIST SEDFNSSTPM ETSPSPPFFS
LLRISERIMC LVLDVSGSMT SYDRLNRMNQ AAKYFLSQII ENRSWVGMVH FSSQATIVHE LIQINSDIER NQLLQTLPTS ANGGTSICSG IKAAFQVFKN
GEYQTDGTEI LLLSDGEDST AKDCIDEVKD SGSIVHFIAL GPSADLAVTN MSILTGGNHK LATDEAQNNG LIDAFGALAS ENADITQKSL QLESKGAILN
NS
LWLNDTVV IDSTLGRDTF FLVTWSKQAP AIYLRDPKGT QTTNFTMDSA SKMAYLSIPG TAQVGVWTYN LEAKENSEIL TITVTSRAAN SSVPPITVNA
KVNTDTNTFP SPMIVYAEVL QGYTPIIGAR VTATIESNSG KTEELVLLDN GAGADAFKDD GVYSRFFTAY SVNGRYSLKV RADGGRNSAR RSLRHPSSRA
AYIPGWVVDG EIQGNPPRPE TTEATQPVLE DFSRTASGGA FVMSNVPIGP LPDVYPPNRI TDLQATLDGE EISLTWTAPG DDYDVGRVQQ YIIRTSKNII
ELRDNFNNSP RVDTTNLTPK EANSEETFAF KPENITEENA TYIFIAIESV DKSSLSSGPS NIAQVALFTP QAEPDPDESP SLSGVSVATI VLSVLGALVL
VCIIVGTTIC ILKNKRSSSA AITKF

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
77 NVS 77 - 87
NVSILIPESWK
Shared ( 5 )
215 NST
285 NSS
342 NRS 334 - 343
YFLSQIIENR
Shared ( 4 )
450 NMS
500 NNS
506 NDT
544 NFT 539 - 552
GTQTTNFTMDSASK
Shared ( 3 )
590 NSS 588 - 601
AANSSVPPITVNAK
Shared ( 3 )
807 NNS
816 NLT
834 NIT 821 - 852
EANSEETFAFKPENITEENATYIFIAIESVDK
Shared ( 3 )
839 NAT 821 - 852
EANSEETFAFKPENITEENATYIFIAIESVDK
Shared ( 3 )
Colon Skeletal_muscle
Amide80 ConA RCA120 ConA
     
       
       
     
       
       
       
 
 
 
       
       
   
 
   
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05