GlycoProtDB ID - GPDB0002934


Protein Name Adhesion G protein-coupled receptor F5
Protein Accession Number G5E8Q8
Gene Adgrf5
Length 1348
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
MRSPRTFTFY FLLLVICSSE AALSTPTEPI VQPSILQEHE LAGEELLRPK RAAAAGDRVA EEYMVDIEIS FENVSFLESI RAHLNNLSFP IRGTEADILN
IAMTTVCTPA GNDLLCFCEK GYQWSEERCL HSLTCQDYDS ALPGGYCSCL KGLPPQGPFC QLPEAFITLK LKVRLNIGFQ EDLKNTSSAL YRSYKTDLER
AFRAGYRTLP GFRSVTVTQF TKGSVVVNYV VRVTSAPLPG SIHKANEQVI QNLNHTYKMD YNSFQGTPSN ETKFTVIPEF IFEGDNVTLE CETEFVTSNT
S
WYYGEKRSD IQNSDKYSIH TTVINNISLI TRLTIYNFTQ HDAGMYGCNV TLDIFEYGTV RKLDVTPIRI LAKEERKVVC DNHPISLNCC SENIANWSSI
EWKQEGKISI LGNPESDLES SCSTYTLKAD GTQCPSGSSG TTVIYTCEFV SAYGARGSKN IAVTFTSVAN LTITRDPISV SEGQSFSITC LSDVSSFDEV
YWNTSAGIKI HPRFYTMRRY QDGAESVLMV KTSTREWNGT YHCIFRYKNS YSIATKDVTV HPLPLVSDIM MDPLEASGLC TSSHQFKCCV EEDAGEEYAV
TFHVDSSSFP AEREVIGKQA CYTYSLPANL PRCPKDIAVF CHFTNAANSS VRSPSMKLKL IPRENVTCQD PIIGIGDPGK VIQKLCQFSG VYGSPGQAIG
GTVTYKCVGT QWKEESRACI SAPINGLLQV AKALIKSPTQ DQKLPTYLRD LSVSAGKEEQ DIRSSPGSLG AIISILDLLS TVPTQVNSEM MRDILATINV
ILDKSALNSW EKLLQQQSNQ SSQFLHSVER FSQALQLGDS TPPFLAHPNV QMKSMVIKRG HPQIYQQQFI FKDSDLWGDV AIDECQLGNL QPDSSIVTVA
FPTLKAILAQ DVQRKTSSNS LVMTTTVSHN IVKPFRISMT FKNNHRSGGK PQCVFWNFSL ANNTGGWDSS GCSVEDDGRD NRDRVFCKCN HLTSFSILMS
PDSPDPGSLL KILLDIISYI GLGFSIVSLA ACLVVEAMVW KSVTKNRTSY MRHICIVNIA FCLLIADIWF IVAGAIHDGR YPLNETACVA ATFFIHFFYL
SVFFWMLTLG LMLFYRLIFI LHDASKSTQK AIAFSLGYGC PLIISSITVG VTQPQEVYMR KNACWLNWED TRALLAFAIP ALIIVVVNVS ITVVVITKIL
RPSIGDKPGK QEKSSLFQIS KSIGVLTPLL GLTWGFGLAT VIQGSNAVFH IIFTLLNAFQ GLFILLFGCL WDQKVQEALL HKFSLSRWSS QHSKSTSIGS
STPVFSMSSP ISRRFNNLFG KTGTYNVSTP ETTSSSLENS SSAYSLLN

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
73 NVS
86 NLS 82 - 92
AHLNNLSFPIR
Unique
185 NTS 175 - 192
LNIGFQEDLKNTSSALYR
Unique
254 NHT 245 - 258
ANEQVIQNLNHTYK
Unique
270 NET 259 - 273
MDYNSFQGTPSNETK
Shared ( 2 )
286 NVT
299 NTS
326 NIS 317 - 332
YSIHTTVINNISLITR
Shared ( 2 )
337 NFT 333 - 361
LTIYNFTQHDAGMYGCNVTLDIFEYGTVR
Shared ( 2 )
333 - 362
LTIYNFTQHDAGMYGCNVTLDIFEYGTVRK
Shared ( 2 )
349 NVT 333 - 361
LTIYNFTQHDAGMYGCNVTLDIFEYGTVR
Shared ( 2 )
333 - 362
LTIYNFTQHDAGMYGCNVTLDIFEYGTVRK
Shared ( 2 )
388 NCC 378 - 403
VVCDNHPISLNCCSENIANWSSIEWK
Shared ( 2 )
396 NWS 378 - 403
VVCDNHPISLNCCSENIANWSSIEWK
Shared ( 2 )
470 NLT
503 NTS
538 NGT 532 - 546
TSTREWNGTYHCIFR
Shared ( 2 )
536 - 546
EWNGTYHCIFR
Shared ( 2 )
648 NSS 636 - 652
DIAVFCHFTNAANSSVR
Shared ( 2 )
665 NVT 660 - 680
LIPRENVTCQDPIIGIGDPGK
Shared ( 2 )
664 - 684
ENVTCQDPIIGIGDPGKVIQK
Shared ( 2 )
664 - 680
ENVTCQDPIIGIGDPGK
Shared ( 2 )
819 NQS 813 - 830
LLQQQSNQSSQFLHSVER
Shared ( 2 )
957 NFS 947 - 984
SGGKPQCVFWNFSLANNTGGWDSSGCSVEDDGRDNRDR
Shared ( 2 )
962 NNT 947 - 982
SGGKPQCVFWNFSLANNTGGWDSSGCSVEDDGRDNR
Shared ( 2 )
947 - 984
SGGKPQCVFWNFSLANNTGGWDSSGCSVEDDGRDNRDR
Shared ( 2 )
1046 NRT
1084 NET
1162 NAC
1188 NVS
1326 NVS
1339 NSS
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach
ConA RCA120 ConA RCA120 Amide80 ConA RCA120 AAL ConA RCA120 AAL(+) AAL(+) AAL ConA RCA120 RCA120 ConA RCA120 ConA RCA120 ConA RCA120
                                           
                               
       
                         
   
         
       
   
 
 
         
           
     
     
 
                                           
                                           
       
                 
         
                           
             
           
                             
                           
             
           
                             
           
                       
   
           
                       
   
                                           
                                           
     
                                   
       
 
             
           
 
   
                 
         
                   
                   
               
             
         
                   
                   
 
   
   
     
   
 
 
 
         
                               
                                   
     
         
                               
                                           
                                           
                                           
                                           
                                           
                                           
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05