GlycoProtDB ID - GPDB0002965


Protein Name Atrial natriuretic peptide-converting enzyme (Fragment)
Protein Accession Number H3BLB2
Gene Corin
Length 1007
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
MFTKRPPALA PEEYSRRADA PKRVLRADRS VGEGCPQKLV TANLLRFLLL VLIPCICALI VLLAILLSFV GTLKRVYFKS NDSEPLVTDG EARVPGVIPV
NTVYYENTGA PSLPPSQSTP AWTPRAPSPE DQSHRNTSTC MNITHSQCQI LPYHSTLAPL LPIVKNMDME KFLKFFTYLH RLSCYQHILL FGCSLAFPEC
VVDGDDRHGL LPCRSFCEAA KEGCESVLGM VNSSWPDSLR CSQFRDHTET NSSVRKSCFS LQQEHGKQSL CGGGESFLCT SGLCVPKKLQ CNGYNDCDDW
SDEAHCNCSK DLFHCGTGKC LHYSLLCDGY DDCGDLSDEQ NCACHSQGLV ECRSGQCIPS TFQCDGDEDC KDGSDEENCS DSQTPCPEGE QGCLGSSCVE
SCAGSSLCDS DSSLSNCSQC EPITLELCMN LPYNHTHYPN YLGHRTQKEA SISWESSLFP ALVQTNCYKY LMFFACTILV PKCDVNTGQR IPPCRLLCEH
SKERCESVLG IVGLQWPEDT DCNQFPEESS DNQTCLLPNE DVEECSPSHF KCRSGRCVLG SRRCDGQADC DDDSDEENCG CKERALWECP FNKQCLKHTL
ICDGFPDCPD SMDEKNCSFC QDNELECANH ECVPRDLWCD GWVDCSDSSD EWGCVTLSKN GNSSSLLTVH KSAKEHHVCA DGWRETLSQL ACKQMGLGEP
SVTKLIPGQE GQQWLRLYPN WENLNGSTLQ ELLVYRHSCP SRSEISLLCS KQDCGRRPAA RMNKRILGGR TSRPGRWPWQ CSLQSEPSGH ICGCVLIAKK
WVLTVAHCFE GREDADVWKV VFGINNLDHP SGFMQTRFVK TILLHPRYSR AVVDYDISVV ELSDDINETS YVRPVCLPSP EEYLEPDTYC YITGWGHMGN
KMPFKLQEGE VRIIPLEQCQ SYFDMKTITN RMICAGYESG TVDSCMGDSG GPLVCERPGG QWTLFGLTSW GSVCFSKVLG PGVYSNVSYF VGWIERQIYI
QTFLQKK

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
81 NDS 80 - 93
SNDSEPLVTDGEAR
Shared ( 5 )
136 NTS 126 - 165
APSPEDQSHRNTSTCMNITHSQCQILPYHSTLAPLLPIVK
Shared ( 5 )
142 NIT 126 - 165
APSPEDQSHRNTSTCMNITHSQCQILPYHSTLAPLLPIVK
Shared ( 5 )
232 NSS
251 NSS 241 - 256
CSQFRDHTETNSSVRK
Shared ( 6 )
295 NDC
307 NCS 288 - 310
KLQCNGYNDCDDWSDEAHCNCSK
Shared ( 5 )
289 - 310
LQCNGYNDCDDWSDEAHCNCSK
Shared ( 5 )
378 NCS
416 NCS
434 NHT
532 NQT
616 NCS 616 - 635
NCSFCQDNELECANHECVPR
Shared ( 6 )
662 NSS 660 - 671
NGNSSSLLTVHK
Shared ( 6 )
725 NGS
867 NET
986 NVS
Heart
Amide80 ConA
 
 
 
   
 
   
 
 
   
   
   
   
 
   
   
   
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05