GlycoProtDB ID - GPDB0002969


Protein Name Atrial natriuretic peptide-converting enzyme (Fragment)
Protein Accession Number H3BLR7
Gene Corin
Length 972
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
TKRPPALAPE EYSRRADAPK RVLRADRSVG EGCPQKLVTA NLLRFLLLVL IPCICALIVL LAILLSFVGT LKRVYFKSND SEPLVTDGEA RVPGVIPVNT
VYYENTGAPS LPPSQSTPAW TPRAPSPEDQ SHRNTSTCMN ITHSQCQILP YHSTLAPLLP IVKNMDMEKF LKFFTYLHRL SCYQHILLFG CSLAFPECVV
DGDDRHGLLP CRSFCEAAKE GCESVLGMVN SSWPDSLRCS QFRDHTETNS SVRKSCFSLQ QEHGKQSLCG GGESFLCTSG LCVPKKLQCN GYNDCDDWSD
EAHCTCHSQG LVECRSGQCI PSTFQCDGDE DCKDGSDEEN CSDSQTPCPE GEQGCLGSSC VESCAGSSLC DSDSSLSNCS QCEPITLELC MNLPYNHTHY
PNYLGHRTQK EASISWESSL FPALVQTNCY KYLMFFACTI LVPKCDVNTG QRIPPCRLLC EHSKERCESV LGIVGLQWPE DTDCNQFPEE SSDNQTCLLP
NEDVEECSPS HFKCRSGRCV LGSRRCDGQA DCDDDSDEEN CGCKERALWE CPFNKQCLKH TLICDGFPDC PDSMDEKNCS FCQDNELECA NHECVPRDLW
CDGWVDCSDS SDEWGCVTLS KNGNSSSLLT VHKSAKEHHV CADGWRETLS QLACKQMGLG EPSVTKLIPG QEGQQWLRLY PNWENLNGST LQELLVYRHS
CPSRSEISLL CSKQDCGRRP AARMNKRILG GRTSRPGRWP WQCSLQSEPS GHICGCVLIA KKWVLTVAHC FEGREDADVW KVVFGINNLD HPSGFMQTRF
VKTILLHPRY SRAVVDYDIS VVELSDDINE TSYVRPVCLP SPEEYLEPDT YCYITGWGHM GNKMPFKLQE GEVRIIPLEQ CQSYFDMKTI TNRMICAGYE
SGTVDSCMGD SGGPLVCERP GGQWTLFGLT SWGSVCFSKV LGPGVYSNVS YFVGWIERQI YIQTFLQKKS QG

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
79 NDS 78 - 91
SNDSEPLVTDGEAR
Shared ( 5 )
134 NTS 124 - 163
APSPEDQSHRNTSTCMNITHSQCQILPYHSTLAPLLPIVK
Shared ( 5 )
140 NIT 124 - 163
APSPEDQSHRNTSTCMNITHSQCQILPYHSTLAPLLPIVK
Shared ( 5 )
230 NSS
249 NSS 239 - 254
CSQFRDHTETNSSVRK
Shared ( 6 )
293 NDC
340 NCS
378 NCS
396 NHT
494 NQT
578 NCS 578 - 597
NCSFCQDNELECANHECVPR
Shared ( 6 )
624 NSS 622 - 633
NGNSSSLLTVHK
Shared ( 6 )
687 NGS
829 NET
948 NVS
Heart
Amide80 ConA
 
 
 
   
 
   
   
   
   
   
 
   
   
   
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05