GlycoProtDB ID - GPDB0003237


Protein Name Carboxypeptidase D
Protein Accession Number O89001
Gene Cpd
Length 1377
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
MASGRDERPP WRLGRLRLLP PPPLLLLLLL LRSSAQAAHI KKAEATTTTV GGSEAAEGQF DHYYHEAALG EALEAAAAAG PPGLARLFSI GSSVEGRPLW
VLRLTAGLGP PPTAAAGLDA AGPLLPGRPQ VKLVGNMHGD ETVSRQVLVY LARELASGYR RGDPRLVRLL NTTDVYLLPS LNPDGFERAR EGDCGLGDSG
PPGTSGRDNS RGRDLNRSFP DQFSTGEPPS LDEVPEVRAL IDWIRRNKFV LSGNLHGGSV VASYPFDDSP EHKTTGLYSK TSDDEVFRYL AKAYASNHPI
MKTGEPHCPG DEDETFKDGI TNGAHWYDVE GGMQDYNYVW ANCFEITLEL SCCKYPPASQ LRQEWENNRE SLITLIEKVH IGIKGFVKDS VTGSGLENAT
ISVAGINHNI TTGRFGDFHR LLVPGTYNLT ALSTGYMPLT INNIMVKEGP ATEMDFSLRP TVMSVMPGST EAVTTPGTVA VPNIPPGTPS SHQPIQPKDF
HHHHFPDMEI FLRRFANEYP NITRLYSLGK SVESRELYVM EISDNPGVHE PGEPEFKYIG NMHGNEVVGR ELLLNLIEYL CKNFGTDPEV TDLVRSTRIH
LMPSMNPDGY EKSQEGDSIS VVGRNNSNNF DLNRNFPDQF VPITEPTQPE TIAVMSWVKA YPFVLSANLH GGSLVVNYPY DDNEQGVATY SKSPDDAVFQ
QIALSYSKEN SQMFQGRPCK DMYLNEYFPH GITNGASWYN VPGGMQDWNY LQTNCFEVTI ELGCVKYPFE NELPKYWEQN RRSLIQFMKQ VHQGVKGFVL
DATDGRGILN ATLSVAEINH PVTTYKAGDY WRLLVPGTYK ITASARGYNP VTKNVTVRSE GAVQVNFTLV RSSADANNES KKGRGHSTST DDTSDPTSKE
FEALIKHLSA ENGLEGFMLS SSSDLALYRY HSYKDLSEFL RGLVMNYPHI TNLTTLGQSV EYRHIWSLEI SNKPNISEPE EPKIRFVAGI HGNAPVGTEL
LLALAEFLCL NYKRNPVVTQ LVDRTRIVIV PSLNPDGRER AQEKDCTSKT GHTNAHGKDL DTDFTSNASQ PETKAIIENL IQKQDFSLSI ALDGGSVLVT
YPYDKPVQTV ENKETLKHLA SLYANNHPSM HMGQPSCPNN SDENIPGGVM RGAEWHSHLG SMKDYSVTYG HCPEITVYTS CCYFPSAAQL PALWAENKKS
LLSMLVEVHK GVHGLVKDKA GKPISKAVIV LNEGIKVYTK EGGYFHVLLA PGVHNINAIA DGYQQQHTQV FVHHDAASSV VIVFDTDNRI FGLPRELVVT
VSGATMSALI LTACIIWCIC SIKSNRHKDG FHRLRQHHDE YEDEIRMMST GSKKSLLSHE FQDETDTEEE TLYSSKH

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
171 NTT 169 - 188
LLNTTDVYLLPSLNPDGFER
Unique
216 NRS
398 NAT 385 - 414
GFVKDSVTGSGLENATISVAGINHNITTGR
Unique
389 - 414
DSVTGSGLENATISVAGINHNITTGR
Unique
409 NIT 385 - 414
GFVKDSVTGSGLENATISVAGINHNITTGR
Unique
389 - 414
DSVTGSGLENATISVAGINHNITTGR
Unique
428 NLT 421 - 447
LLVPGTYNLTALSTGYMPLTINNIMVK
Unique
521 NIT 514 - 524
RFANEYPNITR
Shared ( 4 )
515 - 524
FANEYPNITR
Shared ( 4 )
625 NNS 613 - 634
SQEGDSISVVGRNNSNNFDLNR
Unique
810 NAT 807 - 826
GILNATLSVAEINHPVTTYK
Unique
854 NVT 854 - 871
NVTVRSEGAVQVNFTLVR
Unique
866 NFT 859 - 871
SEGAVQVNFTLVR
Unique
854 - 871
NVTVRSEGAVQVNFTLVR
Unique
878 NES
952 NLT 942 - 963
GLVMNYPHITNLTTLGQSVEYR
Unique
942 - 963
GLVMNYPHITNLTTLGQSVEYR
Unique
975 NIS 964 - 983
HIWSLEISNKPNISEPEEPK
Unique
1067 NAS 1059 - 1074
DLDTDFTSNASQPETK
Unique
1139 NNS 1118 - 1151
HLASLYANNHPSMHMGQPSCPNNSDENIPGGVMR
Unique
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach Testis
ConA Amide80 ConA RCA120 ConA AAL ConA RCA120 AAL(+) AAL(+) RCA120 RCA120 RCA120 ConA ConA RCA120 Amide80 ConA RCA120 ConA RCA120
                 
               
   
                                         
       
 
                         
 
     
 
   
       
 
                         
 
     
 
   
 
                                     
     
             
         
   
         
                   
 
 
                                     
         
   
 
       
 
                                 
     
         
           
         
 
                                 
     
                                         
         
           
             
                       
             
 
       
 
     
 
   
 
 
       
                 
   
 
           
             
     
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05