GlycoProtDB ID - GPDB0003305


Protein Name Alpha-1-antitrypsin 1-1
Protein Accession Number P07758
Gene Serpina1a
Length 413
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MTPSISWGLL LLAGLCCLVP SFLAEDVQET DTSQKDQSPA SHEIATNLGD FAISLYRELV HQSNTSNIFF SPVSIATAFA MLSLGSKGDT HTQILEGLQF
NLTQTSEADI HKSFQHLLQT LNRPDSELQL STGNGLFVNN DLKLVEKFLE EAKNHYQAEV FSVNFAESEE AKKVINDFVE KGTQGKIAEA VKKLDQDTVF
ALANYILFKG KWKKPFDPEN TEEAEFHVDE STTVKVPMMT LSGMLHVHHC STLSSWVLLM DYAGNATAVF LLPDDGKMQH LEQTLSKELI SKFLLNRRRR
LAQIHFPRLS ISGEYNLKTL MSPLGITRIF NNGADLSGIT EENAPLKLSQ AVHKAVLTID ETGTEAAAVT VLQMVPMSMP PILRFDHPFL FIIFEEHTQS
PIFLGKVVDP THK

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
64 NTS 58 - 87
ELVHQSNTSNIFFSPVSIATAFAMLSLGSK
Shared ( 9 )
58 - 76
ELVHQSNTSNIFFSPVSIA
Shared ( 9 )
58 - 87
ELVHQSNTSNIFFSPVSIATAFAMLSLGSK
Shared ( 9 )
101 NLT 88 - 112
GDTHTQILEGLQFNLTQTSEADIHK
Shared ( 7 )
265 NAT
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Serum Skeletal_muscle Stomach Testis
ConA Amide80 ConA RCA120 Amide80 ConA RCA120 AAL RCA120 AAL(+) AAL(+) AAL ConA RCA120 RCA120 RCA120 RCA120 Amide80 Amide80 ConA RCA120 Amide80 ConA RCA120 RCA120
           
 
         
   
             
                   
                           
     
 
   
 
 
           
 
   
 
                                                 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05