GlycoProtDB ID - GPDB0003340


Protein Name 4F2 cell-surface antigen heavy chain
Protein Accession Number P10852
Gene Slc3a2
Length 526
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
MSQDTEVDMK DVELNELEPE KQPMNAADGA AAGEKNGLVK IKVAEDETEA GVKFTGLSKE ELLKVAGSPG WVRTRWALLL LFWLGWLGML AGAVVIIVRA
PRCRELPVQR WWHKGALYRI GDLQAFVGRD AGGIAGLKSH LEYLSTLKVK GLVLGPIHKN QKDEINETDL KQINPTLGSQ EDFKDLLQSA KKKSIHIILD
LTPNYQGQNA WFLPAQADIV ATKMKEALSS WLQDGVDGFQ FRDVGKLMNA PLYLAEWQNI TKNLSEDRLL IAGTESSDLQ QIVNILESTS DLLLTSSYLS
NSTFTGERTE SLVTRFLNAT GSQWCSWSVS QAGLLADFIP DHLLRLYQLL LFTLPGTPVF SYGDELGLQG ALPGQPAKAP LMPWNESSIF HIPRPVSLNM
T
VKGQNEDPG SLLTQFRRLS DLRGKERSLL HGDFHALSSS PDLFSYIRHW DQNERYLVVL NFRDSGRSAR LGASNLPAGI SLPASAKLLL STDSARQSRE
EDTSLKLENL SLNPYEGLLL QFPFVA

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
166 NET 160 - 171
NQKDEINETDLK
Shared ( 8 )
163 - 171
DEINETDLK
Shared ( 8 )
259 NIT 243 - 268
DVGKLMNAPLYLAEWQNITKNLSEDR
Shared ( 8 )
247 - 268
LMNAPLYLAEWQNITKNLSEDR
Shared ( 8 )
247 - 262
LMNAPLYLAEWQNITK
Shared ( 8 )
247 - 268
LMNAPLYLAEWQNITKNLSEDR
Shared ( 8 )
247 - 262
LMNAPLYLAEWQNITK
Shared ( 8 )
254 - 262
LAEWQNITK
Shared ( 8 )
263 NLS 243 - 268
DVGKLMNAPLYLAEWQNITKNLSEDR
Shared ( 8 )
247 - 268
LMNAPLYLAEWQNITKNLSEDR
Shared ( 8 )
247 - 268
LMNAPLYLAEWQNITKNLSEDR
Shared ( 8 )
301 NST 284 - 315
NILESTSDLLLTSSYLSNSTFTGERTESLVTR
Shared ( 6 )
285 - 315
ILESTSDLLLTSSYLSNSTFTGERTESLVTR
Shared ( 6 )
285 - 308
ILESTSDLLLTSSYLSNSTFTGER
Shared ( 6 )
288 - 315
STSDLLLTSSYLSNSTFTGERTESLVTR
Shared ( 6 )
318 NAT 316 - 345
FLNATGSQWCSWSVSQAGLLADFIPDHLLR
Shared ( 6 )
385 NES 379 - 403
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
379 - 403
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
379 - 403
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
379 - 403
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
399 NMT 379 - 403
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
379 - 403
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
379 - 403
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
379 - 403
APLMPWNESSIFHIPRPVSLNMTVK
Shared ( 7 )
391 - 403
HIPRPVSLNMTVK
Shared ( 7 )
509 NLS
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach Testis
AAL ConA RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120 AAL ConA RCA120 AAL(+) AAL(+) AAL RCA120 RCA120 RCA120 RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120 ConA RCA120
                       
                         
                       
                         
                 
                                 
               
       
                       
         
     
 
 
                 
                                 
   
 
   
 
     
 
 
 
                         
                         
                 
                                 
               
       
                       
                 
                                 
                         
                         
                         
                         
                         
                         
                         
                         
                               
                 
       
   
     
     
   
   
     
               
                           
                         
           
           
                 
 
     
 
       
   
     
     
   
   
     
               
                           
                         
           
           
                 
 
     
 
                         
                         
                                                     
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05