GlycoProtDB ID - GPDB0003396


Protein Name Cadherin-2
Protein Accession Number P15116
Gene Cdh2
Length 906
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
MCRIAGAPRT LLPLLAALLQ ASVEASGEIA LCKTGFPEDV YSAVLPKDVH EGQPLLNVKF SNCNRKRKVQ YESSEPADFK VDEDGTVYAV RSFPLTAEQA
KFLIYAQDKE TQEKWQVAVN LSREPTLTEE PMKEPHEIEE IVFPRQLAKH SGALQRQKRD WVIPPINLPE NSRGPFPQEL VRIRSDRDKN LSLRYSVTGP
GADQPPTGIF IINPISGQLS VTKPLDRELI ARFHLRAHAV DINGNQVENP IDIVINVIDM NDNRPEFLHQ VWNGSVPEGS KPGTYVMTVT AIDADDPNAL
NGMLRYRILS QAPSTPSPNM FTINNETGDI ITVAAGLDRE KVQQYTLIIQ ATDMEGNPTY GLSNTATAVI TVTDVNDNPP EFTAMTFYGE VPENRVDVIV
ANLTVTDKDQ PHTPAWNAAY RISGGDPTGR FAILTDPNSN DGLVTVVKPI DFETNRMFVL TVAAENQVPL AKGIQHPPQS TATVSVTVID VNENPYFAPN
PKIIRQEEGL HAGTMLTTLT AQDPDRYMQQ NIRYTKLSDP ANWLKIDPVN GQITTIAVLD RESPNVKNNI YNATFLASDN GIPPMSGTGT LQIYLLDIND
NAPQVLPQEA ETCETPEPNS INITALDYDI DPNAGPFAFD LPLSPVTIKR NWTINRLNGD FAQLNLKIKF LEAGIYEVPI IITDSGNPPK SNISILRVKV
CQCDSNGDCT DVDRIVGAGL GTGAIIAILL CIIILLILVL MFVVWMKRRD KERQAKQLLI DPEDDVRDNI LKYDEEGGGE EDQDYDLSQL QQPDTVEPDA
IKPVGIRRLD ERPIHAEPQY PVRSAAPHPG DIGDFINEGL KAADNDPTAP PYDSLLVFDY EGSGSTAGSL SSLNSSSSGG DQDYDYLNDW GPRFKKLADM
YGGGDD

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
120 NLS
190 NLS
273 NGS
325 NET 308 - 341
ILSQAPSTPSPNMFTINNETGDIITVAAGLDREK
Shared ( 3 )
308 - 341
ILSQAPSTPSPNMFTINNETGDIITVAAGLDREK
Shared ( 3 )
402 NLT
572 NAT
622 NIT
651 NWT 650 - 656
RNWTINR
Shared ( 4 )
692 NIS 691 - 699
SNISILRVK
Shared ( 4 )
670 - 697
FLEAGIYEVPIIITDSGNPPKSNISILR
Shared ( 4 )
874 NSS
Brain Heart Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Stomach
ConA Amide80 ConA AAL(+) AAL(+) RCA120 RCA120 RCA120 RCA120
                 
                 
                 
     
       
 
 
     
                 
                 
                 
 
     
 
           
 
         
     
                 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05