GlycoProtDB ID - GPDB0003505


Protein Name Carboxylesterase 1C
Protein Accession Number P23953
Gene Ces1c
Length 554
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
MWLHALVWAS LAVCPILGHS LLPPVVDTTQ GKVLGKYISL EGFEQPVAVF LGVPFAKPPL GSLRFAPPQP AEPWSFVKNA TSYPPMCSQD AGWAKILSDM
FSTEKEILPL KISEDCLYLN IYSPADLTKS SQLPVMVWIH GGGLVIGGAS PYNGLALSAH ENVVVVTIQY RLGIWGLFST GDEHSPGNWA HLDQLAALRW
VQDNIANFGG NPDSVTIFGE SSGGISVSVL VLSPLGKDLF HRAISESGVV INTNVGKKNI QAVNEIIATL SQCNDTSSAA MVQCLRQKTE SELLEISGKL
VQYNISLSTM IDGVVLPKAP EEILAEKSFN TVPYIVGFNK QEFGWIIPMM LQNLLPEGKM NEETASLLLR RFHSELNISE SMIPAVIEQY LRGVDDPAKK
SELILDMFGD IFFGIPAVLL SRSLRDAGVS TYMYEFRYRP SFVSDKRPQT VEGDHGDEIF FVFGAPLLKE GASEEETNLS KMVMKFWANF ARNGNPNGEG
LPHWPEYDEQ EGYLQIGATT QQAQRLKAEE VAFWTELLAK NPPETDPTEH TEHK

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
79 NAT 79 - 95
NATSYPPMCSQDAGWAK
Unique
65 - 95
FAPPQPAEPWSFVKNATSYPPMCSQDAGWAK
Unique
79 - 95
NATSYPPMCSQDAGWAK
Unique
274 NDT 258 - 286
KNIQAVNEIIATLSQCNDTSSAAMVQCLR
Shared ( 2 )
258 - 286
KNIQAVNEIIATLSQCNDTSSAAMVQCLR
Shared ( 2 )
259 - 286
NIQAVNEIIATLSQCNDTSSAAMVQCLR
Shared ( 2 )
259 - 286
NIQAVNEIIATLSQCNDTSSAAMVQCLR
Shared ( 2 )
304 NIS 300 - 327
LVQYNISLSTMIDGVVLPKAPEEILAEK
Unique
300 - 318
LVQYNISLSTMIDGVVLPK
Shared ( 2 )
377 NIS 371 - 392
RFHSELNISESMIPAVIEQYLR
Unique
372 - 392
FHSELNISESMIPAVIEQYLR
Unique
372 - 392
FHSELNISESMIPAVIEQYLR
Unique
371 - 392
RFHSELNISESMIPAVIEQYLR
Unique
478 NLS 470 - 481
EGASEEETNLSK
Unique
Heart Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Serum
Amide80 ConA RCA120 AAL(+) AAL(+) AAL ConA RCA120 RCA120 RCA120 Amide80
 
     
 
                   
                   
                   
           
     
   
 
     
   
     
                   
                   
                   
           
     
           
     
                   
 
               
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05