GlycoProtDB ID - GPDB0003511


Protein Name Asialoglycoprotein receptor 2
Protein Accession Number P24721
Gene Asgr2
Length 301
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
MEKDCQDIQQ LDSEENDHQL SGDDEHGSHV QDPRIENPHW KGQPLSRPFP QRLCSTFRLS LLALAFNILL LVVICVVSSQ SIQLQEEFRT LKETFSNFSS
STLMEFGALD TLGGSTNAIL TSWLAQLEEK QQQLKADHST LLFHLKHFPM DLRTLTCQLA YFQSNGTECC PVNWVEFGGS CYWFSRDGLT WAEADQYCQL
ENAHLLVINS REEQDFVVKH RSQFHIWIGL TDRDGSWKWV DGTDYRSNYR NWAFTQPDNW QGHEQGGGED CAEILSDGHW NDNFCQQVNR WVCEKRRNIT
H

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
97 NFS
165 NGT 154 - 186
TLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSR
Shared ( 3 )
283 NFC
298 NIT
Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-)
RCA120 RCA120
   
   
   
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05