GlycoProtDB ID - GPDB0003525


Protein Name Alpha-mannosidase 2
Protein Accession Number P27046
Gene Man2a1
Length 1150
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
MKLSRQFTVF GSAIFCVVIF SLYLMLDRGH LDYPRGPRQE GSFPQGQLSI LQEKIDHLER LLAENNEIIS NIRDSVINLS ESVEDGPRGS PGNASQGSIH
LHSPQLALQA DPRDCLFASQ SGSQPRDVQM LDVYDLIPFD NPDGGVWKQG FDIKYEADEW DHEPLQVFVV PHSHNDPGWL KTFNDYFRDK TQYIFNNMVL
KLKEDSSRKF MWSEISYLAK WWDIIDIPKK EAVKSLLQNG QLEIVTGGWV MPDEATPHYF ALIDQLIEGH QWLEKNLGVK PRSGWAIDPF GHSPTMAYLL
KRAGFSHMLI QRVHYAIKKH FSLHKTLEFF WRQNWDLGSA TDILCHMMPF YSYDIPHTCG PDPKICCQFD FKRLPGGRYG CPWGVPPEAI SPGNVQSRAQ
MLLDQYRKKS KLFRTKVLLA PLGDDFRFSE YTEWDLQCRN YEQLFSYMNS QPHLKVKIQF GTLSDYFDAL EKAVAAEKKS SQSVFPALSG DFFTYADRDD
HYWSGYFTSR PFYKRMDRIM ESRIRAAEIL YQLALKQAQK YKINKFLSSP HYTTLTEARR NLGLFQHHDA ITGTAKDWVV VDYGTRLFQS LNSLEKIIGD
SAFLLILKDK KLYQSDPSKA FLEMDTKQSS QDSLPQKIII QLSAQEPRYL VVYNPFEQER HSVVSIRVNS ATVKVLSDSG KPVEVQVSAV WNDMRTISQA
AYEVSFLAHI PPLGLKVFKI LESQSSSSHL ADYVLYNNDG LAENGIFHVK NMVDAGDAIT IENPFLAIWF DRSGLMEKVR RKEDSRQHEL KVQFLWYGTT
NKRDKSGAYL FLPDGQGQPY VSLRPPFVRV TRGRIYSDVT CFLEHVTHKV RLYNIQGIEG QSMEVSNIVN IRNVHNREIV MRISSKINNQ NRYYTDLNGY
QIQPRRTMSK LPLQANVYPM CTMAYIQDAE HRLTLLSAQS LGASSMASGQ IEVFMDRRLM QDDNRGLGQG VHDNKITANL FRILLEKRSA VNMEEEKKSP
VSYPSLLSHM TSSFLNHPFL PMVLSGQLPS PAFELLSEFP LLQSSLPCDI HLVNLRTIQS KMGKGYSDEA ALILHRKGFD CQFSSRGIGL PCSTTQGKMS
VLKLFNKFAV ESLVPSSLSL MHSPPDAQNM SEVSLSPMEI STFRIRLRWT

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
78 NLS
93 NAS 89 - 100
GSPGNASQGSIH
Unique
89 - 113
GSPGNASQGSIHLHSPQLALQADPR
Unique
1129 NMS 1117 - 1144
SLSLMHSPPDAQNMSEVSLSPMEISTFR
Shared ( 2 )
1108 - 1144
FAVESLVPSSLSLMHSPPDAQNMSEVSLSPMEISTFR
Unique
1108 - 1144
FAVESLVPSSLSLMHSPPDAQNMSEVSLSPMEISTFR
Unique
Kidney(Fut9 KO) Kidney(Fut9 WT) Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-)
AAL(+) AAL(+) RCA120 RCA120
       
     
 
   
     
   
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05