GlycoProtDB ID - GPDB0003613


Protein Name CD82 antigen
Protein Accession Number P40237
Gene Cd82
Length 266
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
MGAGCVKVTK YFLFLFNLLF FILGAVILGF GVWILADKNS FISVLQTSSS SLQVGAYVFI GVGAITIVMG FLGCIGAVNE VRCLLGLYFV FLLLILIAQV
TVGVLFYFNA DKLKKEMGNT VMDIIRNYTA NATSSREEAW DYVQAQVKCC GWVSHYNWTE NEELMGFTKT TYPCSCEKIK EEDNQLIVKK GFCEADNSTV
SENNPEDWPV NTEGCMEKAQ AWLQENFGIL LGVCAGVAVI ELLGLFLSIC LCRYIHSEDY SKVPKY

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
127 NYT 116 - 136
EMGNTVMDIIRNYTANATSSR
Shared ( 4 )
127 - 136
NYTANATSSR
Shared ( 4 )
116 - 148
EMGNTVMDIIRNYTANATSSREEAWDYVQAQVK
Shared ( 3 )
127 - 148
NYTANATSSREEAWDYVQAQVK
Shared ( 3 )
127 - 148
NYTANATSSREEAWDYVQAQVK
Shared ( 3 )
116 - 136
EMGNTVMDIIRNYTANATSSR
Shared ( 4 )
116 - 136
EMGNTVMDIIRNYTANATSSR
Shared ( 4 )
131 NAT 116 - 136
EMGNTVMDIIRNYTANATSSR
Shared ( 4 )
127 - 136
NYTANATSSR
Shared ( 4 )
127 - 136
NYTANATSSR
Shared ( 4 )
116 - 148
EMGNTVMDIIRNYTANATSSREEAWDYVQAQVK
Shared ( 3 )
127 - 148
NYTANATSSREEAWDYVQAQVK
Shared ( 3 )
127 - 148
NYTANATSSREEAWDYVQAQVK
Shared ( 3 )
116 - 136
EMGNTVMDIIRNYTANATSSR
Shared ( 4 )
116 - 136
EMGNTVMDIIRNYTANATSSR
Shared ( 4 )
157 NWT 149 - 169
CCGWVSHYNWTENEELMGFTK
Shared ( 3 )
197 NST 191 - 218
GFCEADNSTVSENNPEDWPVNTEGCMEK
Shared ( 2 )
191 - 218
GFCEADNSTVSENNPEDWPVNTEGCMEK
Shared ( 2 )
Brain Heart Kidney Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach
RCA120 Amide80 RCA120 AAL AAL RCA120 WGA RCA120 RCA120 RCA120 RCA120 Amide80 RCA120
       
             
 
                   
                   
 
             
       
               
       
       
     
     
 
 
     
   
       
             
                       
 
                   
                   
 
             
       
             
       
       
     
     
 
 
     
   
             
   
 
               
   
 
             
         
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05