GlycoProtDB ID - GPDB0003614


Protein Name ATP-binding cassette sub-family A member 1
Protein Accession Number P41233
Gene Abca1
Length 2261
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
1101
1201
1301
1401
1501
1601
1701
1801
1901
2001
2101
2201
MACWPQLRLL LWKNLTFRRR QTCQLLLEVA WPLFIFLILI SVRLSYPPYE QHECHFPNKA MPSAGTLPWV QGIICNANNP CFRYPTPGEA PGVVGNFNKS
IVSRLFSDAQ RLLLYSQRDT SIKDMHKVLR MLRQIKHPNS NLKLQDFLVD NETFSGFLQH NLSLPRSTVD SLLQANVGLQ KVFLQGYQLH LASLCNGSKL
EEIIQLGDAE VSALCGLPRK KLDAAERVLR YNMDILKPVV TKLNSTSHLP TQHLAEATTV LLDSLGGLAQ ELFSTKSWSD MRQEVMFLTN VNSSSSSTQI
YQAVSRIVCG HPEGGGLKIK SLNWYEDNNY KALFGGNNTE EDVDTFYDNS TTPYCNDLMK NLESSPLSRI IWKALKPLLV GKILYTPDTP ATRQVMAEVN
KT
FQELAVFH DLEGMWEELS PQIWTFMENS QEMDLVRTLL DSRGNDQFWE QKLDGLDWTA QDIMAFLAKN PEDVQSPNGS VYTWREAFNE TNQAIQTISR
FMECVNLNKL EPIPTEVRLI NKSMELLDER KFWAGIVFTG ITPDSVELPH HVKYKIRMDI DNVERTNKIK DGYWDPGPRA DPFEDMRYVW GGFAYLQDVV
EQAIIRVLTG SEKKTGVYVQ QMPYPCYVDD IFLRVMSRSM PLFMTLAWIY SVAVIIKSIV YEKEARLKET MRIMGLDNGI LWFSWFVSSL IPLLVSAGLL
VVILKLGNLL PYSDPSVVFV FLSVFAMVTI LQCFLISTLF SRANLAAACG GIIYFTLYLP YVLCVAWQDY VGFSIKIFAS LLSPVAFGFG CEYFALFEEQ
GIGVQWDNLF ESPVEEDGFN LTTAVSMMLF DTFLYGVMTW YIEAVFPGQY GIPRPWYFPC TKSYWFGEEI DEKSHPGSSQ KGVSEICMEE EPTHLRLGVS
IQNLVKVYRD GMKVAVDGLA LNFYEGQITS FLGHNGAGKT TTMSILTGLF PPTSGTAYIL GKDIRSEMSS IRQNLGVCPQ HNVLFDMLTV EEHIWFYARL
KGLSEKHVKA EMEQMALDVG LPPSKLKSKT SQLSGGMQRK LSVALAFVGG SKVVILDEPT AGVDPYSRRG IWELLLKYRQ GRTIILSTHH MDEADILGDR
IAIISHGKLC CVGSSLFLKN QLGTGYYLTL VKKDVESSLS SCRNSSSTVS CLKKEDSVSQ SSSDAGLGSD HESDTLTIDV SAISNLIRKH VSEARLVEDI
GHELTYVLPY EAAKEGAFVE LFHEIDDRLS DLGISSYGIS ETTLEEIFLK VAEESGVDAE TSDGTLPARR NRRAFGDKQS CLHPFTEDDA VDPNDSDIDP
ESRETDLLSG MDGKGSYQLK GWKLTQQQFV ALLWKRLLIA RRSRKGFFAQ IVLPAVFVCI ALVFSLIVPP FGKYPSLELQ PWMYNEQYTF VSNDAPEDMG
TQELLNALTK DPGFGTRCME GNPIPDTPCL AGEEDWTISP VPQSIVDLFQ NGNWTMKNPS PACQCSSDKI KKMLPVCPPG AGGLPPPQRK QKTADILQNL
T
GRNISDYLV KTYVQIIAKS LKNKIWVNEF RYGGFSLGVS NSQALPPSHE VNDAIKQMKK LLKLTKDSSA DRFLSSLGRF MAGLDTKNNV KVWFNNKGWH
AISSFLNVIN NAILRANLQK GENPSQYGIT AFNHPLNLTK QQLSEVALMT TSVDVLVSIC VIFAMSFVPA SFVVFLIQER VSKAKHLQFI SGVKPVIYWL
SNFVWDMCNY VVPATLVIII FICFQQKSYV SSTNLPVLAL LLLLYGWSIT PLMYPASFVF KIPSTAYVVL TSVNLFIGIN GSVATFVLEL FTNNKLNDIN
DILKSVFLIF PHFCLGRGLI DMVKNQAMAD ALERFGENRF VSPLSWDLVG RNLFAMAVEG VVFFLITVLI QYRFFIRPRP VKAKLPPLND EDEDVRRERQ
RILDGGGQND ILEIKELTKI YRRKRKPAVD RICIGIPPGE CFGLLGVNGA GKSTTFKMLT GDTPVTRGDA FLNKNSILSN IHEVHQNMGY CPQFDAITEL
LTGREHVEFF ALLRGVPEKE VGKVGEWAIR KLGLVKYGEK YASNYSGGNK RKLSTAMALI GGPPVVFLDE PTTGMDPKAR RFLWNCALSI VKEGRSVVLT
SHSMEECEAL CTRMAIMVNG RFRCLGSVQH LKNRFGDGYT IVVRIAGSNP DLKPVQEFFG LAFPGSVLKE KHRNMLQYQL PSSLSSLARI FSILSQSKKR
LHIEDYSVSQ TTLDQVFVNF AKDQSDDDHL KDLSLHKNQT VVDVAVLTSF LQDEKVKESY V

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
14 NLT
98 NKS 84 - 99
YPTPGEAPGVVGNFNK
Shared ( 2 )
151 NET 144 - 166
LQDFLVDNETFSGFLQHNLSLPR
Shared ( 2 )
161 NLS 144 - 166
LQDFLVDNETFSGFLQHNLSLPR
Shared ( 2 )
144 - 166
LQDFLVDNETFSGFLQHNLSLPR
Shared ( 2 )
196 NGS
244 NST
292 NSS
337 NNT 332 - 360
ALFGGNNTEEDVDTFYDNSTTPYCNDLMK
Shared ( 2 )
349 NST 332 - 360
ALFGGNNTEEDVDTFYDNSTTPYCNDLMK
Shared ( 2 )
400 NKT
478 NGS 470 - 485
NPEDVQSPNGSVYTWR
Unique
470 - 500
NPEDVQSPNGSVYTWREAFNETNQAIQTISR
Unique
489 NET 486 - 500
EAFNETNQAIQTISR
Shared ( 2 )
470 - 500
NPEDVQSPNGSVYTWREAFNETNQAIQTISR
Unique
521 NKS
820 NLT
1144 NSS
1294 NDS
1453 NWT
1499 NLT
1504 NIS
1637 NLT 1621 - 1640
GENPSQYGITAFNHPLNLTK
Unique
1780 NGS
2044 NYS
2238 NQT
Brain Colon Heart Kidney Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach Testis
ConA ConA Amide80 ConA RCA120 ConA AAL ConA RCA120 RCA120 RCA120 ConA RCA120 ConA ConA RCA120 ConA
                                 
       
 
     
       
 
 
 
 
   
 
 
 
 
 
   
 
                 
           
                                 
                                 
                                 
                 
             
                 
             
                                 
     
         
   
       
   
           
             
               
   
       
   
           
             
                                 
                                 
                                 
                                 
                                 
                                 
                                 
   
 
 
     
 
   
                                 
                                 
                                 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05