GlycoProtDB ID - GPDB0003632


Protein Name Cannabinoid receptor 1
Protein Accession Number P47746
Gene Cnr1
Length 473
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MKSILDGLAD TTFRTITTDL LYVGSNDIQY EDIKGDMASK LGYFPQKFPL TSFRGSPFQE KMTAGDNSPL VPAGDTTNIT EFYNKSLSSF KENEDNIQCG
ENFMDMECFM ILNPSQQLAI AVLSLTLGTF TVLENLLVLC VILHSRSLRC RPSYHFIGSL AVADLLGSVI FVYSFVDFHV FHRKDSPNVF LFKLGGVTAS
FTASVGSLFL TAIDRYISIH RPLAYKRIVT RPKAVVAFCL MWTIAIVIAV LPLLGWNCKK LQSVCSDIFP LIDETYLMFW IGVTSVLLLF IVYAYMYILW
KAHSHAVRMI QRGTQKSIII HTSEDGKVQV TRPDQARMDI RLAKTLVLIL VVLIICWGPL LAIMVYDVFG KMNKLIKTVF AFCSMLCLLN STVNPIIYAL
RSKDLRHAFR SMFPSCEGTA QPLDNSMGDS DCLHKHANNT ASMHRAAESC IKSTVKIAKV TMSVSTDTSA EAL

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
78 NIT 62 - 85
MTAGDNSPLVPAGDTTNITEFYNK
Shared ( 2 )
62 - 91
MTAGDNSPLVPAGDTTNITEFYNKSLSSFK
Shared ( 2 )
84 NKS 62 - 85
MTAGDNSPLVPAGDTTNITEFYNK
Shared ( 2 )
62 - 91
MTAGDNSPLVPAGDTTNITEFYNKSLSSFK
Shared ( 2 )
390 NST
438 NNT
Brain
AAL
 
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05