GlycoProtDB ID - GPDB0003704


Protein Name Alpha-2-macroglobulin receptor-associated protein
Protein Accession Number P55302
Gene Lrpap1
Length 360
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
MAPRRERVST LPRLQLLVLL LLPLMLVPQP IAGHGGKYSR EKNEPEMAAK RESGEEFRME KLNQLWEKAK RLHLSPVRLA ELHSDLKIQE RDELNWKKLK
VEGLDKDGEK EAKLIHNLNV ILARYGLDGR KDAQMVHSNA LNEDTQDELG DPRLEKLWHK AKTSGKFSSE ELDKLWREFL HYKEKIQEYN VLLDTLSRAE
EGYENLLSPS DMAHIKSDTL ISKHSELKDR LRSINQGLDR LRKVSHQGYG STTEFEEPRV IDLWDLAQSA NFTEKELESF REELKHFEAK IEKHNHYQKQ
LEISHQKLKH VESIGDPEHI SRNKEKYVLL EEKTKELGYK VKKHLQDLSS RVSRARHNEL

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
271 NFT 260 - 275
VIDLWDLAQSANFTEK
Shared ( 9 )
244 - 275
VSHQGYGSTTEFEEPRVIDLWDLAQSANFTEK
Shared ( 9 )
Brain Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver
ConA ConA ConA AAL(+) AAL(+) AAL
 
 
 
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05