GlycoProtDB ID - GPDB0003791


Protein Name Beta-sarcoglycan
Protein Accession Number P82349
Gene Sgcb
Length 320
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
MAAAAAAAAA TEQQGSNGPV KKSMREKAVE RRNVNKEHNS NFKAGYIPID EDRLHKTGLR GRKGNLAICV IVLLFILAVI NLLITLVIWA VIRIGPNGCD
SMEFHESGLL RFKQVSDMGV IHPLYKSTVG GRRNENLVIT GNNQPIVFQQ GTTKLSVEKN KTSITSDIGM QFFDPRTHNI LFSTDYETHE FHLPSGVKSL
NVQKASTERI TSNATSDLNI KVDGRAIVRG NEGVFIMGKT IEFHMGGDVE LKAENSIILN GTVMVSPTRL PSSSSGDQSG SGDWVRYKLC MCADGTLFKV
QVTGHNMGCQ VSDNPCGNTH

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
97 NGC
160 NKT
213 NAT 210 - 221
ITSNATSDLNIK
Shared ( 2 )
210 - 225
ITSNATSDLNIKVDGR
Shared ( 2 )
205 - 221
ASTERITSNATSDLNIK
Shared ( 2 )
260 NGT 253 - 286
AENSIILNGTVMVSPTRLPSSSSGDQSGSGDWVR
Shared ( 2 )
253 - 288
AENSIILNGTVMVSPTRLPSSSSGDQSGSGDWVRYK
Shared ( 2 )
253 - 286
AENSIILNGTVMVSPTRLPSSSSGDQSGSGDWVR
Shared ( 2 )
Colon Heart Kidney Liver: b4GalT-I(+/+) Lung Skeletal_muscle Stomach Testis
Amide80 ConA RCA120 Amide80 ConA RCA120 RCA120 ConA RCA120 Amide80 ConA ConA RCA120 ConA
                           
                           
 
   
             
           
     
         
     
       
         
   
       
                 
 
 
         
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

GeneID InterPro KEGG MGI Pfam PhosphoSitePlus RefSeq UCSC

24051

IPR006875

IPR027659

mmu:24051

MGI:1346523

PF04790

P82349

NP_036020.1

uc008xtb.1

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05