GlycoProtDB ID - GPDB0003855


Protein Name Beta-2-glycoprotein 1
Protein Accession Number Q01339
Gene Apoh
Length 345
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
MVSPVLALFS AFLCHVAIAG RICPKPDDLP FATVVPLKTS YDPGEQIVYS CKPGYVSRGG MRRFTCPLTG MWPINTLRCV PRVCPFAGIL ENGIVRYTSF
EYPKNISFAC NPGFFLNGTS SSKCTEEGKW SPDIPACARI TCPPPPVPKF ALLKDYRPSA GNNSLYQDTV VFKCLPHFAM IGNDTVMCTE QGNWTRLPEC
LEVKCPFPPR PENGYVNYPA KPVLLYKDKA TFGCHETYKL DGPEEAECTK TGTWSFLPTC RESCKLPVKK ATVLYQGMRV KIQEQFKNGM MHGDKIHFYC
KNKEKKCSYT VEAHCRDGTI EIPSCFKEHS SLAFWKTDAS ELTPC

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
105 NIS 97 - 123
YTSFEYPKNISFACNPGFFLNGTSSSK
Shared ( 4 )
105 - 123
NISFACNPGFFLNGTSSSK
Shared ( 4 )
97 - 129
YTSFEYPKNISFACNPGFFLNGTSSSKCTEEGK
Shared ( 4 )
117 NGT 105 - 123
NISFACNPGFFLNGTSSSK
Shared ( 4 )
97 - 123
YTSFEYPKNISFACNPGFFLNGTSSSK
Shared ( 4 )
105 - 123
NISFACNPGFFLNGTSSSK
Shared ( 4 )
97 - 129
YTSFEYPKNISFACNPGFFLNGTSSSKCTEEGK
Shared ( 4 )
162 NNS 155 - 173
DYRPSAGNNSLYQDTVVFK
Shared ( 3 )
150 - 173
FALLKDYRPSAGNNSLYQDTVVFK
Shared ( 3 )
183 NDT 174 - 204
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
174 - 204
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
174 - 196
CLPHFAMIGNDTVMCTEQGNWTR
Shared ( 3 )
174 - 196
CLPHFAMIGNDTVMCTEQGNWTR
Shared ( 3 )
174 - 196
CLPHFAMIGNDTVMCTEQGNWTR
Shared ( 3 )
174 - 204
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
174 - 204
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
193 NWT 174 - 204
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
174 - 204
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
174 - 204
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
174 - 196
CLPHFAMIGNDTVMCTEQGNWTR
Shared ( 3 )
174 - 196
CLPHFAMIGNDTVMCTEQGNWTR
Shared ( 3 )
174 - 196
CLPHFAMIGNDTVMCTEQGNWTR
Shared ( 3 )
174 - 204
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
174 - 204
CLPHFAMIGNDTVMCTEQGNWTRLPECLEVK
Shared ( 3 )
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Serum Skeletal_muscle Stomach Testis
RCA120 Amide80 ConA RCA120 ConA RCA120 ConA RCA120 AAL(+) AAL(+) AAL ConA RCA120 SSA RCA120 RCA120 ConA RCA120 Amide80 Amide80 RCA120 Amide80 ConA RCA120 RCA120
           
   
 
         
         
     
       
 
 
                                   
           
                           
                   
           
   
 
         
         
     
       
 
 
                                   
           
           
   
         
                                   
           
                           
     
           
 
     
                 
 
                       
                     
                       
                       
                                   
           
       
                 
   
           
       
                         
   
 
                           
     
           
 
     
                 
 
                           
                   
                       
                     
                       
                       
                                   
           
       
                 
   
           
       
                         
   
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05