GlycoProtDB ID - GPDB0004017


Protein Name Cacna2d1 protein
Protein Accession Number Q14BH8
Gene Cacna2d1
Length 1086
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
901
1001
MAAGCLLALT LTLFQSGLIG PSSEEPFPSP VTIKSWVDKM QEDLVTLAKT ASGVTQLADI YEKYQDLYTV EPNNARQLVE IAARDIEKLL SNRSKALVRL
AMEAEKVQAA HQWREDFASN EVVYYNAKDD LDPERNESEP GSQRIKPVFI EDANFGRQIS YQHAAVHIPT DIYEGSTIVL NELNWTSALD EVFKRNRDED
PTLLWQVFGS ATGLARYYPA SPWVDNSRTP NKIDLYDVRR RPWYIQGAAS PKDMLILVDV SGSVSGLTLK LIRTSVSEML ETLSDDDFVN VASFNSNAQD
VSCFQHLVQA NVRNKKVLKD AVNNITAKGI TDYKKGFSFA FEQLLNYNVS RANCNKIIML FTDGGEERAQ EIFAKYNKDK KVRVFTFSVG QHNYDRGPIQ
WMACENKGYY YEIPSIGAIR INTQEYLDVL GRPMVLAGDK AKQVQWTNVY LDALELGLVI TGTLPVFNVT GQSENKTNLK NQLILGVMGV DVSLEDIKRL
TPRFTLCPNG YYFAIDPNGY VLLHPNLQPK EPVTLDFLDA ELENEIKVEI RNKMIDGESG EKTFRTLVKS QDERYIDKGN RTYTWTPVNG TDYSLALVLP
TYSFYYIKAK LEETITQARS KKGKMKDSET LKPDNFEESG YTFIAPREYC NDLKPSDNNT EFLLNFNEFI DRKTPNNPSC NTDLINRILL DAGFTNELVQ
NYWSKQKNIK GVKARFVVTD GGITRVYPKE AGENWQENPE TYEDSFYKRS LDNDNYVFTA PYFNKSGPGA YESGIMVSKA VELYIQGKLL KPAVVGIKID
VNSWIENFTK TSIRDPCAGP VCDCKRNSDV MDCVILDDGG FLLMANHDDY TNQIGRFFGE IDPSMMRHLV NISLYAFNKS YDYQSVCDPG AAPKQGAGHR
SAYVPSIADI LQIGWWATAA AWSILQQLLL SLTFPRLLEA VEMEEDDFTA SLSKQSCITE QTQYFFKNDT KSFSGLLDCG NCSRIFHVEK LMNTNLVFIM
VESKGTCPCD TRLLMQAEQT SDGPDPCDMV KQPRYRKGPD VCFDNNVLED YTDCGGVSGL NPSLWSIFGL QFILLWLVSG SRHYLL

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
92 NRS
136 NES 129 - 144
DDLDPERNESEPGSQR
Shared ( 7 )
184 NWT 158 - 194
QISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFK
Shared ( 7 )
324 NIT 316 - 328
KVLKDAVNNITAK
Shared ( 7 )
317 - 328
VLKDAVNNITAK
Shared ( 7 )
320 - 328
DAVNNITAK
Shared ( 7 )
348 NVS 336 - 351
GFSFAFEQLLNYNVSR
Shared ( 7 )
468 NVT
475 NKT
580 NRT
589 NGT
658 NNT 648 - 673
EYCNDLKPSDNNTEFLLNFNEFIDRK
Shared ( 7 )
764 NKS 749 - 765
RSLDNDNYVFTAPYFNK
Shared ( 7 )
750 - 765
SLDNDNYVFTAPYFNK
Shared ( 7 )
807 NFT 799 - 810
IDVNSWIENFTK
Shared ( 7 )
871 NIS 868 - 879
HLVNISLYAFNK
Shared ( 7 )
878 NKS 868 - 879
HLVNISLYAFNK
Shared ( 7 )
968 NDT 955 - 984
QSCITEQTQYFFKNDTKSFSGLLDCGNCSR
Shared ( 7 )
955 - 984
QSCITEQTQYFFKNDTKSFSGLLDCGNCSR
Shared ( 7 )
955 - 971
QSCITEQTQYFFKNDTK
Shared ( 7 )
955 - 971
QSCITEQTQYFFKNDTK
Shared ( 7 )
981 NCS 955 - 984
QSCITEQTQYFFKNDTKSFSGLLDCGNCSR
Shared ( 7 )
955 - 984
QSCITEQTQYFFKNDTKSFSGLLDCGNCSR
Shared ( 7 )
972 - 984
SFSGLLDCGNCSR
Shared ( 7 )
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach
AAL ConA RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120 AAL ConA AAL(+) AAL(+) AAL ConA RCA120 RCA120 AAL ConA Amide80 ConA RCA120 Amide80 ConA
                                               
         
 
   
   
     
 
                                         
   
 
                                           
 
               
     
     
         
 
         
   
             
         
                     
             
       
                                               
                                               
                                               
                                               
                     
                     
     
   
 
   
             
       
       
   
 
 
   
 
       
 
               
             
     
 
   
 
   
                 
 
   
 
   
                 
                                       
     
                                       
     
 
                               
         
 
                               
         
                                       
     
                                       
     
     
     
   
   
   
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05