GlycoProtDB ID - GPDB0004037


Protein Name Alpha-1B-glycoprotein
Protein Accession Number Q19LI2
Gene A1bg
Length 512
Status
Reviewed
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
MSLLATVLLL WGFTLGPGNT LMLDSGSEPK LWAEPQSLLE PWANLTLVCA VDLPTKVFEL IQNGWFLSQV RLETQVLSYR FSLGAITSNN SGIYRCRCGV
EPPVDIHLPA LNKWTMLSNA VEVTGKEPLP RPLAHADPVD WITPGGLPVY VMCQVAMRGV TYLLRQEGVD GVQKPDVQHK GTAGFLIYKP GNYSCSYLTH
AAGEPSEPSD IVTIKMYASQ APPTLCLMGN YLMIYPQKTY ETLACKAPRN AAEFQLRQGG KVLKIHGFSP TRDAILYYVN LKELDNPGPF TCRYRMHKYM
HVWSEDSKPV ELMWSDETLQ APVLTAEPSS RDLEPGSTVQ LRCTAPVSGL RFGLQRQGKP ELVVVQMLNS SGTEAVFELH NISTIDSGNY SCIYMEQAPP
FSGSSSSEPV ELRVNGPPPK PRLEALWKST VHLGQEAIFR CHGHVPRVSM ELVREGFKTP FAVASTRSTS AYLKLLFVGP QHAGNYSCRY TALPPFTFES
GISDPVEVIV EG

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
44 NLT
89 NNS 81 - 95
FSLGAITSNNSGIYR
Unique
192 NYS 181 - 215
GTAGFLIYKPGNYSCSYLTHAAGEPSEPSDIVTIK
Unique
369 NSS
381 NIS
389 NYS
485 NYS 475 - 489
LLFVGPQHAGNYSCR
Unique
Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Serum
RCA120 RCA120 Amide80
     
 
     
     
     
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05