GlycoProtDB ID - GPDB0004124


Protein Name Carcinoembryonic antigen-related cell adhesion molecule 1
Protein Accession Number Q3LFS5
Gene Ceacam1
Length 450
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MELASAHLHK GQVPWGGLLL TASLLASWSP ATTAEVTIEA VPPQVAEDNN VLLLVHNLPL ALGAFAWYKG NTTAIDKEIA RFVPNSNMNF TGQAYSGREI
IYSNGSLLFQ MITMKDMGVY TLDMTDENYR RTQATVRFHV HPILLKPNIT SNNSNPVEGD DSVSLTCDSY TDPDNINYLW SRNGESLSEG DRLKLSEGNR
T
LTLLNVTRN DTGPYVCETR NPVSVNRSDP FSLNIIYGPD TPIISPSDIY LHPGSNLNLS CHAASNPPAQ YFWLINEKPH ASSQELFIPN ITTNNSGTYT
CFVNNSVTGL SRTTVKNITV LEPVTQPFLQ VTNTTVKELD SVTLTCLSND IGANIQWLFN SQSLQLTERM TLSQNNSILR IDPIKREDAG EYQCEISNPV
SVRRSNSIKL DIIWEVTSEI SQSTNPQPPT TIWLLLTTLL TRWMTSHTLS

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
71 NTT 70 - 81
GNTTAIDKEIAR
Shared ( 10 )
89 NFT 82 - 98
FVPNSNMNFTGQAYSGR
Shared ( 10 )
82 - 98
FVPNSNMNFTGQAYSGR
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
104 NGS 82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
99 - 115
EIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
99 - 115
EIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
148 NIT
152 NNS
199 NRT 195 - 209
LSEGNRTLTLLNVTR
Shared ( 8 )
195 - 220
LSEGNRTLTLLNVTRNDTGPYVCETR
Shared ( 8 )
206 NVT 195 - 209
LSEGNRTLTLLNVTR
Shared ( 8 )
195 - 220
LSEGNRTLTLLNVTRNDTGPYVCETR
Shared ( 8 )
201 - 220
TLTLLNVTRNDTGPYVCETR
Shared ( 8 )
201 - 209
TLTLLNVTR
Shared ( 8 )
201 - 227
TLTLLNVTRNDTGPYVCETRNPVSVNR
Shared ( 8 )
210 NDT 195 - 220
LSEGNRTLTLLNVTRNDTGPYVCETR
Shared ( 8 )
201 - 220
TLTLLNVTRNDTGPYVCETR
Shared ( 8 )
210 - 220
NDTGPYVCETR
Shared ( 8 )
210 - 227
NDTGPYVCETRNPVSVNR
Shared ( 8 )
201 - 227
TLTLLNVTRNDTGPYVCETRNPVSVNR
Shared ( 8 )
226 NRS 210 - 227
NDTGPYVCETRNPVSVNR
Shared ( 8 )
201 - 227
TLTLLNVTRNDTGPYVCETRNPVSVNR
Shared ( 8 )
258 NLS
290 NIT
294 NNS 279 - 312
PHASSQELFIPNITTNNSGTYTCFVNNSVTGLSR
Shared ( 6 )
304 NNS 279 - 312
PHASSQELFIPNITTNNSGTYTCFVNNSVTGLSR
Shared ( 6 )
317 NIT 317 - 337
NITVLEPVTQPFLQVTNTTVK
Shared ( 4 )
313 - 337
TTVKNITVLEPVTQPFLQVTNTTVK
Shared ( 4 )
333 NTT 317 - 337
NITVLEPVTQPFLQVTNTTVK
Shared ( 4 )
313 - 337
TTVKNITVLEPVTQPFLQVTNTTVK
Shared ( 4 )
317 - 337
NITVLEPVTQPFLQVTNTTVK
Shared ( 4 )
375 NNS 370 - 385
MTLSQNNSILRIDPIK
Shared ( 14 )
370 - 385
MTLSQNNSILRIDPIK
Shared ( 14 )
370 - 380
MTLSQNNSILR
Shared ( 14 )
370 - 380
MTLSQNNSILR
Shared ( 14 )
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach
RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120 AAL ConA RCA120 AAL(+) AAL(+) AAL ConA RCA120 SSA WGA RCA120 RCA120 ConA RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120
                       
       
             
 
 
   
 
   
       
   
 
   
 
   
 
           
 
                                                 
           
                                       
         
                                         
         
                                       
     
                                           
         
                                         
 
   
                           
   
 
 
                                                 
           
                                       
         
                                         
           
                   
                 
         
                                       
 
       
                     
               
     
                                           
         
                                         
 
   
                           
   
 
                                                     
                                                     
                                 
               
                                 
               
                                 
               
                                 
               
   
       
 
 
 
 
 
       
                           
 
               
                                   
               
                                 
               
   
       
 
 
 
 
 
       
                                 
               
                                 
               
                                   
               
                                 
               
                                   
               
                                                     
                                                     
                   
                               
                   
                               
     
 
     
           
     
   
             
 
   
 
                     
     
 
     
           
     
   
             
 
   
 
                     
                                   
               
 
   
                                           
 
                                                 
 
 
 
 
       
 
 
       
           
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05