GlycoProtDB ID - GPDB0004125


Protein Name Carcinoembryonic antigen-related cell adhesion molecule 1
Protein Accession Number Q3LFS6
Gene Ceacam1
Length 270
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
MELASAHLHK GQVPWGGLLL TASLLASWSP ATTAEVTIEA VPPQVAEDNN VLLLVHNLPL ALGAFAWYKG NTTAIDKEIA RFVPNSNMNF TGQAYSGREI
IYSNGSLLFQ MITMKDMGVY TLDMTDENYR RTQATVRFHV HQPVTQPFLQ VTNTTVKELD SVTLTCLSND IGANIQWLFN SQSLQLTERM TLSQNNSILR
IDPIKREDAG EYQCEISNPV SVRRSNSIKL DIIWEVTSEI SQSTNPQPPT TIWLLLTTLL TRWMTSHTLS

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
71 NTT 70 - 81
GNTTAIDKEIAR
Shared ( 10 )
89 NFT 82 - 98
FVPNSNMNFTGQAYSGR
Shared ( 10 )
82 - 98
FVPNSNMNFTGQAYSGR
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
104 NGS 82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
99 - 115
EIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
99 - 115
EIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
153 NTT 138 - 157
FHVHQPVTQPFLQVTNTTVK
Shared ( 5 )
195 NNS 190 - 205
MTLSQNNSILRIDPIK
Shared ( 14 )
190 - 205
MTLSQNNSILRIDPIK
Shared ( 14 )
190 - 200
MTLSQNNSILR
Shared ( 14 )
190 - 200
MTLSQNNSILR
Shared ( 14 )
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach
RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120 AAL ConA RCA120 AAL(+) AAL(+) AAL ConA RCA120 SSA WGA RCA120 RCA120 ConA RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120
                       
       
             
 
 
   
 
   
       
   
 
   
 
   
 
           
 
                                                 
           
                                       
         
                                         
         
                                       
     
                                           
         
                                         
 
   
                           
   
 
 
                                                 
           
                                       
         
                                         
           
                   
                 
         
                                       
 
       
                     
               
     
                                           
         
                                         
 
   
                           
   
 
 
 
 
         
 
   
 
 
 
   
                                           
 
                                                 
 
 
 
 
       
 
 
       
           
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05