GlycoProtDB ID - GPDB0004128


Protein Name CEA-related cell adhesion molecule 1, isoform 1/2L
Protein Accession Number Q3LFS9
Gene Ceacam1
Length 341
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
MELASAHLHK GQVPWGGLLL TASLLASWSP ATTAEVTIEA VPPQVAEDNN VLLLVHNLPL ALGAFAWYKG NTTAIDKEIA RFVPNSNMNF TGQAYSGREI
IYSNGSLLFQ MITMKDMGVY TLDMTDENYR RTQATVRFHV HQPVTQPFLQ VTNTTVKELD SVTLTCLSND IGANIQWLFN SQSLQLTERM TLSQNNSILR
IDPIKREDAG EYQCEISNPV SVRRSNSIKL DIIFDPTQGG LSDGAIAGIV IGVVAGVALI AGLAYFLYSR KSGGGSDQRD LTEHKPSASN HNLAPSDNSP
NKVDDVAYTV LNFNSQQPNR PTSAPSSPRA TETVYSEVKK K

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
71 NTT 70 - 81
GNTTAIDKEIAR
Shared ( 10 )
89 NFT 82 - 98
FVPNSNMNFTGQAYSGR
Shared ( 10 )
82 - 98
FVPNSNMNFTGQAYSGR
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
104 NGS 82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
99 - 115
EIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
99 - 115
EIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
82 - 115
FVPNSNMNFTGQAYSGREIIYSNGSLLFQMITMK
Shared ( 10 )
153 NTT 138 - 157
FHVHQPVTQPFLQVTNTTVK
Shared ( 5 )
195 NNS 190 - 205
MTLSQNNSILRIDPIK
Shared ( 14 )
190 - 205
MTLSQNNSILRIDPIK
Shared ( 14 )
190 - 200
MTLSQNNSILR
Shared ( 14 )
190 - 200
MTLSQNNSILR
Shared ( 14 )
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach
RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120 AAL ConA RCA120 AAL(+) AAL(+) AAL ConA RCA120 SSA WGA RCA120 RCA120 ConA RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120
                       
       
             
 
 
   
 
   
       
   
 
   
 
   
 
           
 
                                                 
           
                                       
         
                                         
         
                                       
     
                                           
         
                                         
 
   
                           
   
 
 
                                                 
           
                                       
         
                                         
           
                   
                 
         
                                       
 
       
                     
               
     
                                           
         
                                         
 
   
                           
   
 
 
 
 
         
 
   
 
 
 
   
                                           
 
                                                 
 
 
 
 
       
 
 
       
           
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05