GlycoProtDB ID - GPDB0004275


Protein Name ATPase, H+ transporting, lysosomal accessory protein
Protein Accession Number Q3TKX1
Gene Atp6ap1
Length 415
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MMAATVVSRI RTGTGRAPVM WLSLSLVAVA AAVATEQQVP LVLWSSDRNL WAPVADTHEG HITSDMQLST YLDPALELGP RNVLLFLQDK LSIEDFTAYG
GVFGNKQDSA FSNLENALDL APSSLVLPAV DWYAISTLTT YLQEKLGASP LHVDLATLKE LKLNASLPAL LLIRLPYTAS SGLMAPREVL TGNDEVIGQV
LSTLKSEDVP YTAALTAVRP SRVARDITMV AGGLGRQLLQ TQVASPAIHP PVSYNDTAPR ILFWAQNFSV AYKDEWKDLT SLTFGVENLN LTGSFWNDSF
AMLSLTYEPL FGATVTFKFI LASRFYPVSA RYWFAMERLE IHSNGSVAHF NVSQVTGPSI YSFHCEYVSS VSKKGNLLVT NVPSVWQMTL HNFQNPSSYC
VWNLVEPSDP CQCVS

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
164 NAS 163 - 187
LNASLPALLLIRLPYTASSGLMAPR
Shared ( 8 )
163 - 174
LNASLPALLLIR
Shared ( 13 )
255 NDT 243 - 260
VASPAIHPPVSYNDTAPR
Shared ( 9 )
245 - 260
SPAIHPPVSYNDTAPR
Shared ( 9 )
240 - 260
QTQVASPAIHPPVSYNDTAPR
Shared ( 9 )
244 - 260
ASPAIHPPVSYNDTAPR
Shared ( 9 )
237 - 260
QLLQTQVASPAIHPPVSYNDTAPR
Shared ( 9 )
237 - 260
QLLQTQVASPAIHPPVSYNDTAPR
Shared ( 9 )
241 - 260
TQVASPAIHPPVSYNDTAPR
Shared ( 9 )
247 - 260
AIHPPVSYNDTAPR
Shared ( 9 )
267 NFS
290 NLT
297 NDS
344 NGS 339 - 373
LEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSVSK
Shared ( 8 )
351 NVS 339 - 373
LEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSVSK
Shared ( 8 )
339 - 373
LEIHSNGSVAHFNVSQVTGPSIYSFHCEYVSSVSK
Shared ( 8 )
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach Testis
ConA Amide80 ConA ConA AAL(+) AAL(+) ConA RCA120 RCA120 ConA ConA Amide80 ConA ConA
 
                       
 
 
 
   
       
                 
       
               
       
               
       
               
 
   
     
   
 
                     
       
               
       
                 
                           
                           
                           
   
 
     
 
 
 
                       
 
   
 
     
 
 
 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05