GlycoProtDB ID - GPDB0004315


Protein Name Amiloride-sensitive sodium channel subunit beta
Protein Accession Number Q3TP51
Gene Scnn1b
Length 502
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
MPVKKYLLKC LHRLQKGPGY TYKELLVWYC NNTNTHGPKR IICEGPKKKA MWFLLTLLFA CLVCWQWGVF IQTYLSWEVS VSLSMGFKTM NFPAVTVCNS
S
PFQYSKVKH LLKDLDELME AVLEKILAPE ASHSNTTRTL NFTIWNHTPL VLIDERNPDH PVVLNLFGDS HNSSNPAPGS TCNAQGCKVA MRLCSANGTV
CTLRNFTSAT QAVTEWYILQ ATNIFSQVLP QDLVGMGYAP DRIILACLFG TEPCSHRNFT PIFYPDYGNC YIFNWGMTEE TLPSANPGTE FGLKLILDIG
QEDYVPFLAS TAGARLMLHE QRTYPFIREE GIYAMAGTET SIGVLVDKLQ RKGEPYSPCT MNGSDVAIKN LYSVYNTTYS IQACLHSCFQ DHMIRNCSCG
HYLYPLPEGE KYCNNRDFPD WAYCYLNLQM SVTQRETCLS MCKESCNDTQ YKMTISMADW PSEASEDWIL HVLSQERDQS SNITLSRPGL NLPTAENSSD
WR

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
31 NNT
99 NSS
135 NTT 126 - 138
ILAPEASHSNTTR
Shared ( 3 )
141 NFT
146 NHT
172 NSS 157 - 188
NPDHPVVLNLFGDSHNSSNPAPGSTCNAQGCK
Shared ( 3 )
197 NGT 193 - 204
LCSANGTVCTLR
Shared ( 3 )
205 NFT
258 NFT
362 NGS 353 - 369
GEPYSPCTMNGSDVAIK
Shared ( 3 )
352 - 369
KGEPYSPCTMNGSDVAIK
Shared ( 3 )
352 - 369
KGEPYSPCTMNGSDVAIK
Shared ( 3 )
376 NTT
396 NCS
447 NDT
482 NIT
497 NSS
Kidney Lung Stomach
ConA RCA120 ConA RCA120 ConA
         
         
 
         
         
   
   
 
 
         
         
       
 
   
       
         
         
         
         
         
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05