GlycoProtDB ID - GPDB0004333


Protein Name Alkaline phosphatase
Protein Accession Number Q3TQ02
Gene Alpl
Length 524
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
MISPFLVLAI GTCLTNSFVP EKERDPSYWR QQAQETLKNA LKLQKLSTNV AKNVIMFLGD GMGVSTVTAA RILKGQLHHN TGEETRLEMD KFPFVALSKT
YNTNAQVPDS AGTATAYLCG VKANEGTVGV SAATERTRCN TTQGNEVTSI LRWAKDAGKS VGIVTTTRVN HATPSAAYAH SADRDWYSDN EMPPEALSQG
CKDIAYQLMH NIKDIDVIMG GGRKYMYPKN RTDVEYELDE KARGTRLDGL DLISIWKSFK PRHKHSHYVW NRTELLALDP TRVDYLLGLF EPGDMQYELN
RNNLTDPSLS EMVEVALRIL TKNLKGFFLL VEGGRIDHGH HEGKAKQALH EAVEMDQAIG KAGAMTSQKD TLTVVTADHS HVFTFGGYTP RGNSIFGLAP
MVSDTDKKPF TAILYGNGPG YKVVDGEREN VSMVDYAHNN YQAQSAVPLR HETHGGEDVA VFAKGPMAHL LHGVHEQNYI PHVMAYASCI GANLDHCAWA
GSGSAPSPGA LLLPLAVLSL RTLF

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
140 NTT 139 - 152
CNTTQGNEVTSILR
Shared ( 7 )
137 - 152
TRCNTTQGNEVTSILR
Shared ( 7 )
230 NRT 230 - 241
NRTDVEYELDEK
Shared ( 6 )
271 NRT
303 NLT
430 NVS 423 - 439
VVDGERENVSMVDYAHN
Shared ( 6 )
423 - 450
VVDGERENVSMVDYAHNNYQAQSAVPLR
Shared ( 6 )
423 - 444
VVDGERENVSMVDYAHNNYQAQ
Shared ( 6 )
423 - 450
VVDGERENVSMVDYAHNNYQAQSAVPLR
Shared ( 6 )
423 - 464
VVDGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAK
Shared ( 5 )
423 - 464
VVDGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAK
Shared ( 5 )
423 - 440
VVDGERENVSMVDYAHNN
Shared ( 6 )
423 - 443
VVDGERENVSMVDYAHNNYQA
Shared ( 6 )
Brain Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Skeletal_muscle Stomach Testis
RCA120 Amide80 AAL ConA RCA120 AAL(+) AAL(+) RCA120 RCA120 Amide80 Amide80 RCA120
     
       
   
 
 
 
   
                       
                       
         
           
         
       
           
         
       
             
         
         
         
         
         
         
           
         
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05