GlycoProtDB ID - GPDB0004688


Protein Name Cathepsin C, isoform CRA_b
Protein Accession Number Q3UBY5
Gene Ctsc
Length 462
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
MGPWTHSLRA VLLLVLLGVC TVRSDTPANC TYPDLLGTWV FQVGPRSSRS DINCSVMEAT EEKVVVHLKK LDTAYDELGN SGHFTLIYNQ GFEIVLNDYK
WFAFFKYEVR GHTAISYCHE TMTGWVHDVL GRNWACFVGK KVESHIEKVN MNAAHLGGLQ ERYSERLYTH NHNFVKAINT VQKSWTATAY KEYEKMSLRD
LIRRSGHSQR IPRPKPAPMT DEIQQQILNL PESWDWRNVQ GVNYVSPVRN QESCGSCYSF ASMGMLEARI RILTNNSQTP ILSPQEVVSC SPYAQGCDGG
FPYLIAGKYA QDFGVVEESC FPYTAKDSPC KPRENCLRYY SSDYYYVGGF YGGCNEALMK LELVKHGPMA VAFEVHDDFL HYHSGIYHHT GLSDPFNPFE
LTNHAVLLVG YGRDPVTGIE YWIIKNSWGS NWGESGYFRI RRGTDECAIE SIAVAAIPIP KL

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
29 NCT
53 NCS 50 - 63
SDINCSVMEATEEK
Shared ( 8 )
50 - 69
SDINCSVMEATEEKVVVHLK
Shared ( 8 )
47 - 63
SSRSDINCSVMEATEEK
Shared ( 8 )
275 NNS 270 - 308
IRILTNNSQTPILSPQEVVSCSPYAQGCDGGFPYLIAGK
Shared ( 6 )
272 - 308
ILTNNSQTPILSPQEVVSCSPYAQGCDGGFPYLIAGK
Shared ( 7 )
Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Skeletal_muscle Stomach
Amide80 ConA ConA AAL(+) AAL(+) ConA RCA120 RCA120 RCA120 ConA Amide80 ConA ConA
                         
       
       
 
 
                 
     
 
           
       
 
   
   
 
 
           
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05