GlycoProtDB ID - GPDB0004735


Protein Name Alpha-2-HS-glycoprotein, isoform CRA_a
Protein Accession Number Q3UEK9
Gene Ahsg
Length 345
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
MKSLVLLLCF AQLWGCQSAP QGTGLGFREL ACDDPEAEQV ALLAVDYLNN HLLQGFKQVL NQIDKVKVWS RRPFGVVYEM EVDTLETTCH ALDPTPLANC
S
VRQLTEHAV EGDCDFHILK QDGQFRVMHT QCHSTPDSAE DVRKLCPRCP LLTPFNDTNV VHTVNTALAA FNTQNNGTYF KLVEISRAQN VPLPVSTLVE
FVIAATDCTA KEVTDPAKCN LLAEKQHGFC KANLMHNLGG EEVSVACKLF QTQPQPANAN AVGPVPTANA ALPADPPASV VVGPVVVPRG LSDHRTYHDL
RHAFSPVASV ESASGETLHS PKVGQPGAAG PVSPMCPGRI RHFKI

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
99 NCS 68 - 103
VWSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVR
Shared ( 3 )
90 - 103
HALDPTPLANCSVR
Shared ( 4 )
72 - 103
RPFGVVYEMEVDTLETTCHALDPTPLANCSVR
Shared ( 4 )
89 - 103
CHALDPTPLANCSVR
Shared ( 4 )
94 - 103
PTPLANCSVR
Shared ( 4 )
91 - 103
ALDPTPLANCSVR
Shared ( 4 )
72 - 103
RPFGVVYEMEVDTLETTCHALDPTPLANCSVR
Shared ( 4 )
156 NDT 149 - 181
CPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFK
Shared ( 5 )
149 - 167
CPLLTPFNDTNVVHTVNTA
Shared ( 5 )
149 - 181
CPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFK
Shared ( 5 )
149 - 162
CPLLTPFNDTNVVH
Shared ( 5 )
149 - 187
CPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFKLVEISR
Shared ( 5 )
145 - 181
LCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFK
Shared ( 5 )
176 NGT 172 - 181
NTQNNGTYFK
Shared ( 5 )
149 - 181
CPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFK
Shared ( 5 )
149 - 181
CPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFK
Shared ( 5 )
149 - 181
CPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFK
Shared ( 5 )
149 - 187
CPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFKLVEISR
Shared ( 5 )
145 - 181
LCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFK
Shared ( 5 )
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Liver Liver: b4GalT-I(+/+) Liver: b4GalT-I(-/-) Lung Serum Skeletal_muscle Stomach Testis
ConA RCA120 Amide80 ConA RCA120 Amide80 ConA RCA120 AAL ConA RCA120 AAL(+) AAL(+) AAL ConA RCA120 SSA RCA120 RCA120 ConA RCA120 Amide80 Amide80 ConA RCA120 RCA120 RCA120
                                         
         
                     
                           
                     
             
         
                       
                           
                     
                           
                     
                           
                     
               
         
 
                       
                           
               
                                   
                     
                           
                                         
         
             
                                     
                       
                           
 
     
   
             
     
     
   
                         
 
 
                 
                                         
         
             
                                     
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05