GlycoProtDB ID - GPDB0004765


Protein Name A disintegrin and metallopeptidase domain 9 (Meltrin gamma), isoform CRA_a
Protein Accession Number Q3UG15
Gene Adam9
Length 845
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
601
701
801
MGPRALSPLA SLRLRWLLAC GLLGPVLEAG RPDLEQTVHL SSYEIITPWR LTRERREALG PSSQQISYVI QAQGKQHIIH LERNTDLLPN DFVVYTYDKE
GSLLSDHPNV QSHCHYRGYV EGVQNSAVAV SACFGLRGLL HLENASFGIE PLHNSSHFEH IFYPMDGIHQ EPLRCGVSNR DTEKEGTQGD EEEHPSVTQL
LRRRRAVLPQ TRYVELFIVV DKERYDMMGR NQTAVREEMI RLANYLDSMY IMLNIRIVLV GLEIWTDRNP INIIGGAGDV LGNFVQWREK FLITRRRHDS
AQLVLKKGFG GTAGMAFVGT VCSRSHAGGI NVFGQITVET FASIVAHELG HNLGMNHDDG RECFCGAKSC IMNSGASGSR NFSSCSAEDF EKLTLNKGGS
CLLNIPKPDE AYSAPSCGNK LVDPGEECDC GTAKECEVDP CCEGSTCKLK SFAECAYGDC CKDCQFLPGG SMCRGKTSEC DVPEYCNGSS QFCPPDVFIQ
NGYPCQNSKA YCYNGMCQYY DAQCQVIFGS KAKAAPRDCF IEVNSKGDRF GNCGFSGSEY KKCATGNALC GKLQCENVQD MPVFGIVPAI IQTPSRGTKC
WGVDFQLGSD VPDPGMVNEG TKCDAGKICR NFQCVNASVL NYDCDIQGKC HGHGVCNSNK NCHCEDGWAP PHCDTKGYGG SVDSGPTYNA KSTALRDGLL
VFFFLIVPLV AAAIFLFIKR DELRKTFRKK RSQMSDGRNQ ANVSRQPGDP SISRPPGGPN VSRPPGGPGV SRPPGGPGVS RPPGGPGVSR PPPGHGNRFP
VPTYAAKQPA QFPSRPPPPQ PKISSQGNLI PARPAPAPPL YSSLT

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
144 NAS 138 - 174
GLLHLENASFGIEPLHNSSHFEHIFYPMDGIHQEPLR
Shared ( 6 )
154 NSS 138 - 174
GLLHLENASFGIEPLHNSSHFEHIFYPMDGIHQEPLR
Shared ( 6 )
231 NQT 231 - 241
NQTAVREEMIR
Shared ( 5 )
381 NFS 369 - 392
SCIMNSGASGSRNFSSCSAEDFEK
Shared ( 5 )
487 NGS
636 NAS 631 - 649
NFQCVNASVLNYDCDIQGK
Shared ( 5 )
742 NVS
760 NVS
Colon Heart Kidney(Fut9 KO) Kidney(Fut9 WT) Skeletal_muscle Stomach
Amide80 ConA AAL(+) AAL(+) ConA ConA
       
 
       
 
 
       
   
           
   
 
           
           
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05