GlycoProtDB ID - GPDB0004910


Protein Name Amino acid transporter
Protein Accession Number Q3US35
Gene Slc1a4
Length 532
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
401
501
MEKSGETNGY LDGTQAEPAA GPRTPETAMG KSQRCASFFR RHALVLLTVS GVLVGAGMGA ALRGLQLTRT QITYLAFPGE MLLRMLRMII LPLVVCSLVS
GAASLDASSL GRLGGIAVAY FGLTTLSASA LAVALAFIIK PGAGAQTLQS SSLGLENSGP PPVSKETVDS FLDLLRNLFP SNLVVAAFTT SATDYTVVTH
NTSSGNVTKE KIHVVTDVEG MNILGLVLFA LVLGVALKKL GPEGEDLIRF FNSFNEATMV LVSWIMWYVP IGIMFLIGSK IVEMKDIVML VTSLGKYIFA
SMLGHVIHGG IVLPLVYFAF TRKNPFTFLL GLLTPFATAF ATCSSSATLP SMMKCIEENN GVDKRISRFI LPIGATVNMD GAAIFQCVAA VFIAQLNNVD
LNAGQIFTIL VTATASSVGA AGVPAGGVLT IAIILEAIGL PTHDLSLILA VDWIVDRTTT VVNVEGDALG AGILNHLNQK VVKKGEQELQ EVKVEAIPNS
KSEEETSPLV THQNPAGPVA IAPELESKES VL

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
201 NTS 177 - 209
NLFPSNLVVAAFTTSATDYTVVTHNTSSGNVTK
Shared ( 6 )
177 - 209
NLFPSNLVVAAFTTSATDYTVVTHNTSSGNVTK
Shared ( 6 )
206 NVT 177 - 209
NLFPSNLVVAAFTTSATDYTVVTHNTSSGNVTK
Shared ( 6 )
Brain Liver: b4GalT-I(-/-)
AAL RCA120 RCA120
   
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Sugahara D, Kaji H, Sugihara K, Asano M, Narimatsu H Large-scale identification of target proteins of a glycosyltransferase isozyme by Lectin-IGOT-LC/MS, an LC/MS-based glycoproteomic approach Sci Rep 2012;2(): PMID:23002422
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05