GlycoProtDB ID - GPDB0005190


Protein Name CD34 antigen, isoform CRA_b
Protein Accession Number Q543B6
Gene Cd34
Length 382
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
MQVHRDTRAG LLLPWRWVAL CLMSLLHLNN LTSATTETST QGISPSVPTN ESVEENITSS IPGSTSHYLI YQDSSKTTPA ISETMVNFTV TSGIPSGSGT
PHTFSQPQTS PTGILPTTSD SISTSEMTWK SSLPSINVSD YSPNNSSFEM TSPTEPYAYT SSSAPSAIKG EIKCSGIREV RLAQGICLEL SEASSCEEFK
KEKGEDLIQI LCEKEEAEAD AGASVCSLLL AQSEVRPECL LMVLANSTEL PSKLQLMEKH QSDLRKLGIQ SFNKQDIGSH QSYSRKTLIA LVTSGVLLAI
LGTTGYFLMN RRSWSPTGER LGEDPYYTEN GGGQGYSSGP GASPETQGKA NVTRGAQENG TGQATSRNGH SARQHVVADT EL

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
30 NLT
50 NES
56 NIT
87 NFT
137 NVS
144 NNS
145 NSS
246 NST 242 - 253
MVLANSTELPSK
Shared ( 5 )
215 - 253
EEAEADAGASVCSLLLAQSEVRPECLLMVLANSTELPSK
Shared ( 5 )
239 - 253
CLLMVLANSTELPSK
Shared ( 5 )
230 - 253
LAQSEVRPECLLMVLANSTELPSK
Shared ( 5 )
243 - 253
VLANSTELPSK
Shared ( 6 )
351 NVT
359 NGT
Colon Heart Kidney(Fut9 KO) Kidney(Fut9 WT) Skeletal_muscle Stomach
RCA120 Amide80 AAL(+) AAL(+) RCA120 RCA120
           
           
           
           
           
           
           
     
   
   
     
   
     
   
   
   
           
           
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05