GlycoProtDB ID - GPDB0005195


Protein Name Cathepsin L
Protein Accession Number Q543M3
Gene Ctsl
Length 334
Status
release : 2016-12-05

Glycosylation Sites

Schema of N-glycosylation site(s) of the protein

Sequence

(__:Potential Sequon , N:Identified Site)

1
101
201
301
MNLLLLLAVL CLGTALATPK FDQTFSAEWH QWKSTHRRLY GTNEEEWRRA IWEKNMRMIQ LHNGEYSNGQ HGFSMEMNAF GDMTNEEFRQ VVNGYRHQKH
KKGRLFQEPL MLKIPKSVDW REKGCVTPVK NQGQCGSCWA FSASGCLEGQ MFLKTGKLIS LSEQNLVDCS HAQGNQGCNG GLMDFAFQYI KENGGLDSEE
SYPYEAKDGS CKYRAEFAVA NDTGFVDIPQ QEKALMKAVA TVGPISVAMD ASHPSLQFYS SGIYYEPNCS SKNLDHGVLL VGYGYEGTDS NKNKYWLVKN
SWGSEWGMEG YIKIAKDRDN HCGLATAASY PVVN

N-glycosylation sites

Potential sites Identified Peptide*1
Position Sequon Position Sequence Unique or Shared
221 NDT 213 - 233
YRAEFAVANDTGFVDIPQQEK
Shared ( 8 )
215 - 233
AEFAVANDTGFVDIPQQEK
Shared ( 8 )
268 NCS 238 - 272
AVATVGPISVAMDASHPSLQFYSSGIYYEPNCSSK
Shared ( 9 )
320 NHC
Brain Colon Heart Kidney Kidney(Fut9 KO) Kidney(Fut9 WT) Skeletal_muscle
ConA ConA RCA120 ConA ConA AAL(+) AAL(+) Amide80 ConA
     
       
               
                 
*1:   _:Potential Sequon     :Asn (glycosylated)     :Gln (deaminated:pyroGlu)     :Met (oxidized)     :Cys (carbamidomethylated and deaminated)

External Links

Publications

Noro E, Togayachi A, Sato T, Tomioka A, Fujita M, Sukegawa M, Suzuki N, Kaji H, Narimatsu H Large-Scale Identification of N-Glycan Glycoproteins Carrying Lewis x and Site-Specific N-Glycan Alterations in Fut9 Knockout Mice. J Proteome Res 2015;14(9):3823-34 PMID:26244810
Kaji H, Shikanai T, Sasaki-Sawa A, et al Large-scale Identification of N-Glycosylated Proteins of Mouse Tissues and Construction of a Glycoprotein Database, GlycoProtDB J Proteome Res 2012;11(9):4553-4566 PMID:22823882
Kaji H, Yamauchi Y, Takahashi N, Isobe T Mass spectrometric identification of N-linked glycopeptides using lectin-mediated affinity capture and glycosylation site--specific stable isotope tagging Nat Protocols 2007;1(6):3019-3027 PMID:17406563

Entry information

Entry version 2016-12-05
protein sequence version 2016-12-05
Entry status Latest version
Entry history

create : 2016-12-05